DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp1b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_005158614.1 Gene:larp1b ZFINID:ZDB-GENE-030131-4154 Length:1111 Species:Danio rerio

Alignment Length:1523 Identity:436/1524 (29%)
Similarity:632/1524 (41%) Gaps:479/1524 (31%)


  Fly   148 RGDGQKPQQAG-------GRRVPGSSDTERKSVRPRAPRGGSPRKSAAGAAGAAGSNAGAVSSAV 205
            :.|..:|:||.       |::.|...||:.       |:.|.....|.|.:..:.::        
Zfish    23 KSDADRPEQADRTTSHEEGQQDPPQGDTKH-------PKQGVMESKADGLSTDSTND-------- 72

  Fly   206 PGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGDQQAGEKGAAGAAPPPKRFIAAPPPKVNAWK 270
                      |:...:|       |.:||::|                 .|:.:.|||||||.| 
Zfish    73 ----------KENEQNA-------SSHEAETA-----------------KKKVVEAPPPKVNPW- 102

  Fly   271 ISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGATTTT 335
                                           ||:.:...||..|::      ||.:||       
Zfish   103 -------------------------------TKRNSCPPNNTNNSS------QQTEPQ------- 123

  Fly   336 QTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKKKV 400
                                       |.|..|.|:                       |.:.:.
Zfish   124 ---------------------------SPAKVVRAS-----------------------KPRSRK 138

  Fly   401 NQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNV 465
            ..|:||||::.:|||       .|:..:.|.::|....|....|:.......:....:...||..
Zfish   139 TSKSSDFSDITNWPT-------PGELANKEQQQNVINTQGRKGTSGRRERKKDHGGEKRDKESGS 196

  Fly   466 AGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTK 530
            .|:.|..|....|::.|               ..|::.:|: |.|...:||              
Zfish   197 DGSDSKENREAQSNSIT---------------GLSNEQEAE-DGEETHSSA-------------- 231

  Fly   531 KIPKHKWRPLPIDLAKSSRPKPIGG-RPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHA 594
                               |:..|| |..|.|.||                              
Zfish   232 -------------------PRRRGGWRRERDFFDD------------------------------ 247

  Fly   595 GRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRG 659
                                       ||:...:.|...||....|.|.|   ||        ||
Zfish   248 ---------------------------TASVRSEGSNVRGGLRGRGKGRG---RG--------RG 274

  Fly   660 GRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYF--GNVPAAYI 722
            ..:|||.:|.      :||           .:||..::..|:..::.|    :|:  ||....| 
Zfish   275 RGRGRGDYSL------SYR-----------DSYLDGNSVPAEFGTNMV----YYYNDGNRVQMY- 317

  Fly   723 ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAI 787
            .::.|.:||.||:|:|||||:.||..||||||:||.:|::|::||||||||.|||||:.:|..|:
Zfish   318 TIEENLLKEYIKRQIEYYFSLPNLERDFFLRRRMDSKGFLPISLIASFHRVQALTTDINLIKEAL 382

  Fly   788 KESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSP 852
            |.|:.:||.: .::|.|..|..|||..:                                ..|||
Zfish   383 KNSEVVELVD-EQIRRKEEPEQWPIPAL--------------------------------ALDSP 414

  Fly   853 PPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAA 917
            ....:..:               |....||          ..|..:|::|:: |.:.|.::..:.
Zfish   415 RTDFSQLI---------------NCPEFVP----------GQTFTSLSTVSS-SPVNQHMDEPSL 453

  Fly   918 ELAGHLSGLAESVKPKS-TSTPDKRNAASAGNGAG--SAAALVAEPEG-IWKEVKRRSKTNAIKE 978
             :.|..|...::.||:| .|:|....::|..:|:.  ..::.:::|:. .|.:|::|.:..:.|.
Zfish   454 -VNGQTSDETDTAKPQSKESSPSDSKSSSGEDGSNLKERSSSLSDPDAQPWIQVEKRHRNTSGKN 517

  Fly   979 NATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATT 1043
            ..:..|....||                        |:..|....|............||.:...
Zfish   518 KTSVTPLPPSPP------------------------SSPPPPPPPSPPPPIPRLEFFPSAERTEL 558

  Fly  1044 KTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGT 1108
            ..:|                                 |..|..|::|||||.||||:.....|  
Zfish   559 VQST---------------------------------PKPQPEADQEELDFLFDEEMEQLAAP-- 588

  Fly  1109 GRINNFTENFSDDDESDYEFADRDINKLLIVAQV-GRAPKHEGYDRTADFTSRTKITQDLENIIN 1172
             |.|.||: :|||| ||.|..|||:||:|||.|. ....||.|.|||.:..||.|||.||...||
Zfish   589 -RKNTFTD-WSDDD-SDDELDDRDVNKILIVTQTPPHLRKHPGGDRTGNHVSRAKITADLAKAIN 650

  Fly  1173 DGLVNYEEDLWT---------TTNVVADYKTVNVISQADFEKLAGGRNKSVLPPQVVPPPPPFEE 1228
            |||..||:||||         ....:.::|.:|:|||.:||.|.  ....:.|.|.||||||.:.
Zfish   651 DGLFYYEQDLWTKEEGPPECANAKEMENFKKLNMISQDEFETLT--PKLPIDPNQEVPPPPPCQT 713

  Fly  1229 D---LDETLVGDTTLNSTLNNTLKSRRA----------RFYAA--PNSHSIDPRTPRKRKLRHTA 1278
            |   :..:|..|...:|::..|.::.|.          |||..  .:|.::|.:||||||.||::
Zfish   714 DDSSMAHSLPADVPESSSVPRTPRTPRTPGRQDPTKTPRFYPVIKEDSGNLDGKTPRKRKTRHSS 778

  Fly  1279 NPPVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTASS---YGSFGSSVPQSLPVFQHPSHALLKEN 1340
            |||:|.||||::|:.||||||:|: ||:..||:..:   .||:|.: |||||.|.||||.||:||
Zfish   779 NPPLECHVGWVMDSREHRPRTSSI-SSSNASPSEGAPALSGSYGCT-PQSLPKFWHPSHELLREN 841

  Fly  1341 NFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFR 1405
            .||||.||||..|||.||:|||.|||||||||:||||||||:|||:.||.|||..|:||:...:|
Zfish   842 GFTQQVYHKYRRRCLNERKRLGVGQSQEMNTLFRFWSFFLRDNFNRKMYEEFRQFAVEDSKENYR 906

  Fly  1406 YGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLA 1470
            |||||||||:|||||::|||:|::|||:||:.|||.|||||||||||||||.| .:..::.|||.
Zfish   907 YGLECLFRFYSYGLERRFRPDIFKDFQEETVQDYEKGQLYGLEKFWAFLKYSK-VKNQDIDPKLK 970

  Fly  1471 EYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQL--NRHRSVSESDGTAVIAAGGRRLNTTITN 1533
            |||..||:|:||||..|...|.::.....:.|.::  .||.|.|.|..|.:....... .||...
Zfish   971 EYLSKFKSIDDFRVEPPMAEEGMRRKAHSSAGDEVKRRRHNSTSSSKQTQITKTSSDN-QTTAKT 1034

  Fly  1534 RSDYVGRLLQQQHQQQQQQQHHQYQQGYGGYNQQQNRRRTGSFGSTTVRIRSGSLGNKPQVANRN 1598
            ..|..|.....:                 ..||...:..:.:.....:..:|.|...:|..|...
Zfish  1035 AHDQAGASAATK-----------------STNQPAAKAASANQKPAPLTAKSSSANEQPAKAPPK 1082

  Fly  1599 QGSQHELRRGGSNSGLAPHKRQQQQKPK 1626
            :..:.........:..|..|.::.|:||
Zfish  1083 ENVKKNTSSDARKAEAATSKNKEAQQPK 1110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 42/73 (58%)
DM15 1341..1382 CDD:128927 33/41 (80%)
DM15 1383..1421 CDD:128927 26/38 (68%)
larp1bXP_005158614.1 LARP_1_2 325..397 CDD:153403 42/73 (58%)
DM15 843..883 CDD:128927 33/40 (83%)
DM15 884..922 CDD:128927 26/38 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121171136
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 552 1.000 Inparanoid score I1073
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.