DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp6b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001082877.1 Gene:larp6b ZFINID:ZDB-GENE-041008-244 Length:471 Species:Danio rerio

Alignment Length:159 Identity:45/160 (28%)
Similarity:72/160 (45%) Gaps:25/160 (16%)


  Fly   727 NSIKEAIKKQVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNA 786
            :.:.:.|..|:|.|.|.:||:.|.||     |.||   ||:.:.|:.||.::..||.|....:.|
Zfish    59 DDVTQQIATQLENYLSDENLSDDAFLLKHVQRNKM---GYVSLKLLTSFKKIRDLTRDWRTTLAA 120

  Fly   787 IKESDKLELFE-GYKVRTKTTPTTWPITEVPEVNEGEPKAI-------GTLEQEQLEQNDGQEKL 843
            .:.|.:||:.| |.|||.:|....|.:. :|     ..|.:       |....::..::.|.|:|
Zfish   121 ARTSPQLEVNEMGTKVRRRTPVPDWLLC-IP-----TSKLLLAWNFLDGAGPVKEKFESPGVEQL 179

  Fly   844 ---EEQTEADSPPPILTSAMATKPLNSIP 869
               |......||...::|....:|...||
Zfish   180 GIMEAAMRVFSPYGTISSLRILRPGKEIP 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 30/79 (38%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
larp6bNP_001082877.1 LARP_6 62..138 CDD:153402 30/79 (38%)
RRM_SF 153..261 CDD:302621 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.