DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp4b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_021325871.1 Gene:larp4b ZFINID:ZDB-GENE-061027-39 Length:1862 Species:Danio rerio

Alignment Length:779 Identity:149/780 (19%)
Similarity:245/780 (31%) Gaps:240/780 (31%)


  Fly   689 YANYLPADAAGA----DSQSSYVLMGTHYFGNVPAAY------------------IEL------- 724
            :|||:|...|.|    |||.|:|.........:...|                  :||       
Zfish  1178 WANYMPKPEASAPTCPDSQQSWVEAADDPSNCISDGYNNSEDKGNWNEEQQVSTSVELPFAAQPE 1242

  Fly   725 -------------------------DANS------IKEAIKKQVEYYFSVDNLTGDFFLRRKMDP 758
                                     |::|      ::|.:|..:|:..|.:||..|.:|..:||.
Zfish  1243 SVYLGSSVIEKGIVSNQNTSMKGVDDSDSSRQLEDLREQLKATLEFCLSRENLANDMYLISQMDS 1307

  Fly   759 EGYIPVTLIASFHRVLALTTDVAVIVNAIK-----ESDKLELFEGYKVR---------TKTTPTT 809
            :.|:|:..:|:..::..|||||.:|.:.:|     :.||.    |.|||         .:..|..
Zfish  1308 DQYVPIVTLANLDQIKKLTTDVDLISDILKTLPLVQVDKC----GEKVRPNQNRCIVILREIPEA 1368

  Fly   810 WPITEVPEV--NEGEPKAIG-----------TLEQEQLEQNDGQ---EKLEEQTEADSPPP---- 854
            .|:.||..:  ::..||.|.           |.|.|.    |.|   :.|.|:.:.....|    
Zfish  1369 TPLEEVEALFKSDNLPKFINCEFAYNDNWFITFESEA----DAQLAYQYLREEVKTFQGKPIKAR 1429

  Fly   855 ILTSAMATK---PLNSIPPPPMPRNPQN-----LVPKMLQDKQQSRSSTIAALNSVNAISALTQQ 911
            |...|:|..   |.|...|..:..|.|.     .:|.:...:||.....:......:|..:....
Zfish  1430 IKAKAIAVNTFVPKNGYRPVDVSSNVQQRYTPYYIPPVYGAQQQFPLYRLVTPQGWSATQSYLDP 1494

  Fly   912 VEGGAAELAGHLSGLAESVKPKSTSTP-DKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNA 975
            ...........::|.|.|...||.::| ..|:...|..........:..|         ..:...
Zfish  1495 TLVSPFPSPAFINGFAGSPTFKSATSPLTVRHYTHAPRNRNHNKTHIRLP---------TDRGTT 1550

  Fly   976 IKEN----ATTP----PQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTT 1032
            :.||    :|.|    |...:||            :|::..|:.:..:..|........:..:..
Zfish  1551 LLENPAAFSTFPTERIPNGTRPP------------QTHHLGSRPRLPTGLAYPRRDQVGSGRMEV 1603

  Fly  1033 NNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSS---SKTAAPPSAQCHAEKEELDF 1094
            |.|..:..|               ...:.|...|.|....:.   |.|.:||..|  .......|
Zfish  1604 NGADYSLNA---------------GRGRRGGFGYRKRRDDNKFPRSGTQSPPPVQ--ERTPSPSF 1651

  Fly  1095 QFDEELMDPLPPGTGRINNFT--ENFSDDDESDYEFA---DRDINKLLIVAQVGRAPKHEGYDRT 1154
            :.......|||...|.:....  ||..|:..||....   |:.:||.::.::|......|.....
Zfish  1652 ELGLSSFPPLPGAAGNLKPEVKPENSLDNRLSDVVIGAVKDKPLNKDVVTSRVISGTPKESVQAA 1716

  Fly  1155 ADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKTVNVISQADFEKLAGGRNKSVLPPQV 1219
            ....::|.:                           |::.....:|..              |..
Zfish  1717 PAPAAQTPV---------------------------DHQHSPSPAQTS--------------PTA 1740

  Fly  1220 VPPP----PPFEEDLDETLVGDTTLNSTLNNTLKSR-RARFYA-------------------APN 1260
            |..|    .|.|:..|......|.|::.:..:|:.. |...||                   ||:
Zfish  1741 VEKPKETQTPAEKCSDTHAAKTTPLSNPVTVSLQQEPRKPSYAEICQRIREAPTQQPSADPRAPS 1805

  Fly  1261 SHSIDPRTP--RKRKLRHTANPPVEAHVGWLLDTVEHRPR-TTSMGSSAGTSPTASSYGSFGSS 1321
            |.:.|.:||  .:|:.:.:|:.|.::       |....|| |.....|.|...||.:..||..|
Zfish  1806 STAEDVKTPDSAERRCKESASAPAKS-------TATACPRETVKSQQSPGDRATAGTTASFHQS 1862

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/87 (30%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
larp4bXP_021325871.1 LARP_5 1279..1353 CDD:153405 26/78 (33%)
RRM_LARP5 1358..1434 CDD:241150 16/80 (20%)
Atrophin-1 <1632..1862 CDD:331285 54/280 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121322891
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.