DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP6

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_060827.2 Gene:LARP6 HGNCID:24012 Length:491 Species:Homo sapiens

Alignment Length:605 Identity:120/606 (20%)
Similarity:194/606 (32%) Gaps:189/606 (31%)


  Fly   601 SRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRG 665
            :||...|:.::......:.......||:......|||           .|.||.:|      |.|
Human     8 ARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAG-----------DPARYLSP------GWG 55

  Fly   666 GFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIK 730
            ..|.:.|.|                .:....|:|.:::..          ::...:...|...||
Human    56 SASEEEPSR----------------GHSGTTASGGENERE----------DLEQEWKPPDEELIK 94

  Fly   731 EAIKKQVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKES 790
            :.: .|:|:|||.:||..|.||     |.|:   ||:.|.|:.||.:|..||.|.....:|:|.|
Human    95 KLV-DQIEFYFSDENLEKDAFLLKHVRRNKL---GYVSVKLLTSFKKVKHLTRDWRTTAHALKYS 155

  Fly   791 DKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPI 855
            ..|||.|.::...:|||.                                               
Human   156 VVLELNEDHRKVRRTTPV----------------------------------------------- 173

  Fly   856 LTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELA 920
                           |..|.  :||..|||.......|..:.||.:......:.::|.....:|.
Human   174 ---------------PLFPN--ENLPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLF 221

  Fly   921 GHLSGLAESV---KPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAI------ 976
            |.. |:..||   ||.....||.|..:|..:..|:....:.|    ::||:...|.:..      
Human   222 GTF-GVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVE----FEEVEAAIKAHEFMITESQ 281

  Fly   977 -KEN------ATTPPQQ---------QQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSS 1025
             |||      ...||::         ::|..|..||.:. |.:..........||.|:.|:..|:
Human   282 GKENMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSL-NKRVEELQYMGDESSANSSSDPESN 345

  Fly  1026 ATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQ-----C 1085
            .    |:..|.....||.|.:.:.......:.|.....:.:|...::....:...|.|:     |
Human   346 P----TSPMAGRRHAATNKLSPSGHQNLFLSPNASPCTSPWSSPLAQRKGVSRKSPLAEEGRLNC 406

  Fly  1086 HAEKEE----LDFQFDEELMDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAP 1146
            ....|.    :|:..|..:   .|.|:..:....:                       |::|...
Human   407 STSPEIFRKCMDYSSDSSV---TPSGSPWVRRRRQ-----------------------AEMGTQE 445

  Fly  1147 KHEGYDRTADFTSRTKITQD 1166
            |..|   |:...||...|.|
Human   446 KSPG---TSPLLSRKMQTAD 462

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 30/78 (38%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP6NP_060827.2 LARP_6 93..169 CDD:153402 31/80 (39%)
RRM_LARP6 184..292 CDD:240735 26/113 (23%)
Nuclear export signal 186..193 1/7 (14%)
Nuclear localization signal 296..302 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121291255
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.