DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP1B

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_016863827.1 Gene:LARP1B HGNCID:24704 Length:1143 Species:Homo sapiens

Alignment Length:1481 Identity:428/1482 (29%)
Similarity:572/1482 (39%) Gaps:516/1482 (35%)


  Fly   157 AGGRRVPGSSDTERKSVRPRAPR---------------GGSPRKSAAGAAGAAGSNAGAV----- 201
            |..|..|.:...||:|:...|.|               ....|.:||.:|||.|..:.|:     
Human    10 AHSREDPPAVTAERESLLAAANRPAEQPPPPECEGKEAAREERAAAATSAGARGEPSPALVLGRS 74

  Fly   202 --SSAVPGGP----KVHKDRKDTSPSASIEGAGSSGNEAKSADGDQQAGEKGAAGAAPPPKRFIA 260
              .:|||..|    ..||.|                            |..|..|..|||     
Human    75 VPQAAVPVRPLALHLAHKAR----------------------------GPGGPFGGEPPP----- 106

  Fly   261 APPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQ 325
             |||.                 .|||...:..|.|:..:::.....::           |.|...
Human   107 -PPPP-----------------PSPLPPLLRDPPAEDAREEVAAGPAE-----------KRQPPL 142

  Fly   326 QPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALA 390
            .|.:|...|.:.....:...|........|..|               |..:...:.|.      
Human   143 LPPKGNPWTKKPPQHLSPDTTGPPPPPLETLEA---------------EFGSLKIIKAG------ 186

  Fly   391 KVVVKDKKKVNQKASDFSNVGDWPT---LIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASS 452
                |.|.|.:.||||||::.:|||   |:  .:|.....|...|:...:|::..|    |...|
Human   187 ----KLKTKKSNKASDFSDMENWPTPSELV--NTGFQSVLSQGNKKPQNRKEKEEK----VEKRS 241

  Fly   453 NTTSSE-VATESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSA 516
            |:.|.| ..|:.|..|...|.:...||:                          ||         
Human   242 NSDSKENRETKLNGPGENVSEDEAQSSN--------------------------QR--------- 271

  Fly   517 AGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPG 581
                         |:..||||.||.:|:.:|.                  .|.||          
Human   272 -------------KRANKHKWVPLHLDVVRSE------------------SQERP---------- 295

  Fly   582 AGGAGVESR-HPHAGRHPYGSRPATATSERVD--SWRSSSSTTTAAFDEQRSGAAGGAGAAGTGV 643
              |:...|| .|.|.:..:.:|       |.|  ||:..........|.....:.||        
Human   296 --GSRNSSRCQPEANKPTHNNR-------RNDTRSWKRDREKRDDQDDVSSVRSEGG-------- 343

  Fly   644 GSATRGPRRYRTPYRGGRQGRGGFSRQGPGRP------TYRIPRHLLASGEYANYLPADAAGADS 702
                    ..|..:||..:|||....:|.|.|      :|....|    ||..:. |.......|
Human   344 --------NIRGSFRGRGRGRGRGRGRGRGNPRLNFDYSYGYQEH----GERTDQ-PFQTELNTS 395

  Fly   703 QSSYVLMGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLI 767
            ...|      |..........::...:||.||:|:||||||:||..|||||.|||.:|::|::||
Human   396 MMYY------YDDGTGVQVYPVEEALLKEYIKRQIEYYFSVENLERDFFLRGKMDEQGFLPISLI 454

  Fly   768 ASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQE 832
            |.|.||.||||::.:|:.|:|:|.::|:.: .|:|.|..|..|||...|      |:::...:..
Human   455 AGFQRVQALTTNLNLILEALKDSTEVEIVD-EKMRKKIEPEKWPIPGPP------PRSVPPTDFS 512

  Fly   833 QLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIA 897
            ||              .|.|..:...|..:. ..|.|..|...:|       |..|:.|.:|.:.
Human   513 QL--------------IDCPEFVPGQAFCSH-TESAPNSPRIGSP-------LSPKKNSETSILQ 555

  Fly   898 ALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEG 962
            |::                       .||       |||.||                |.:||  
Human   556 AMS-----------------------RGL-------STSLPD----------------LDSEP-- 572

  Fly   963 IWKEVKRRSKTNAIK--ENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSS 1025
             |.|||:|.:...:|  |:.:.|                       ..|.::..|:..|      
Human   573 -WIEVKKRHQPAPVKLRESVSVP-----------------------EGSLNQLCSSEEP------ 607

  Fly  1026 ATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKE 1090
                                                                          |:|
Human   608 --------------------------------------------------------------EQE 610

  Fly  1091 ELDFQFDEELMDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQV-GRAPKHEGYDRT 1154
            ||||.||||:..     .||.|.||: :||:| ||||..|:|:||:|||.|. ....||.|.|||
Human   611 ELDFLFDEEIEQ-----IGRKNTFTD-WSDND-SDYEIDDQDLNKILIVTQTPPYVKKHPGGDRT 668

  Fly  1155 ADFTSRTKITQDLENIINDGLVNYEEDLW---------TTTNVVADYKTVNVISQADFEKLAGGR 1210
            ....||.|||.:|..:|||||..||:|||         .....|.::|.:|:||:..||.|.  .
Human   669 GTHMSRAKITSELAKVINDGLYYYEQDLWMEEDENKHTAIKQEVENFKKLNLISKEQFENLT--P 731

  Fly  1211 NKSVLPPQVVPPPPP---------------------------------------------FEEDL 1230
            .....|.|.||..|.                                             ..::|
Human   732 ELPFEPNQEVPVAPSQSRQEECWRHKMSWRCSRSASHSQERIIILVTVKKMDWERKWQMYLTDEL 796

  Fly  1231 DETLVGDTTLNSTL-----------------NNTLKSRRA----------RFY-AAPNSHSIDPR 1267
            .:.|...:.:.|..                 ..|.|:.|.          ||| ......:||.:
Human   797 AQKLFDVSEITSAAMVHSLPTAVPESPRIHPTRTPKTPRTPRLQDPNKTPRFYPVVKEPKAIDVK 861

  Fly  1268 TPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSSAGT----SPTASSYGSFGSSVPQSLPV 1328
            :|||||.||:.|||:|.||||::|:.:..|.|:|:.:|..:    :|.|.|||    ..|.|.|.
Human   862 SPRKRKTRHSTNPPLECHVGWVMDSRDRGPGTSSVSTSNASPSEGAPLAGSYG----CTPHSFPK 922

  Fly  1329 FQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFR 1393
            ||||||.|||||.||||.||||..|||.||:|||.|||||||||:||||||||::|||.||.|||
Human   923 FQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFR 987

  Fly  1394 SLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYK 1458
            .||.|||...:||||||||||:|||||||||..|:||||:||..|||:|||||||||||:|| |.
Human   988 QLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLK-YS 1051

  Fly  1459 NGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRHR 1509
            ..:...:.|||.|||.|||.:|||||..|..:|..:...|...|.:.||||
Human  1052 QSKTQSIDPKLQEYLCSFKRLEDFRVDPPISDEFGRKRHSSTSGEESNRHR 1102

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 40/73 (55%)
DM15 1341..1382 CDD:128927 33/41 (80%)
DM15 1383..1421 CDD:128927 28/38 (74%)
LARP1BXP_016863827.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121185480
eggNOG 1 0.900 E1_COG5193
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 551 1.000 Inparanoid score I1118
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T609611
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22792
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.