DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP7

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001357903.1 Gene:LARP7 HGNCID:24912 Length:595 Species:Homo sapiens

Alignment Length:435 Identity:95/436 (22%)
Similarity:161/436 (37%) Gaps:146/436 (33%)


  Fly   733 IKKQVEYYFSVDNLTGDFFLRRKMDP--EGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLEL 795
            |.|||:::|...||..|.|||.:::.  :||:.::|:.||:::..||||..:|..|::.|..:||
Human    38 IAKQVDFWFGDANLHKDRFLREQIEKSRDGYVDISLLVSFNKMKKLTTDGKLIARALRSSAVVEL 102

  Fly   796 -FEGYKVRTKTTPTTWPITEVPE---------------VNE------------------------ 820
             .||.::|.|.     |:.|.|:               ||.                        
Human   103 DLEGTRIRRKK-----PLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKST 162

  Fly   821 GEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKML 885
            |:||....:|.|..||                     :|.|.:.||: ||...||.| .:.||.:
Human   163 GDPKGFAFVEFETKEQ---------------------AAKAIEFLNN-PPEEAPRKP-GIFPKTV 204

  Fly   886 QDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGA 950
            ::|      .|.||..|.  ....::.:.|..:...::....|::...:||.             
Human   205 KNK------PIPALRVVE--EKKKKKKKKGRMKKEDNIQAKEENMDTSNTSI------------- 248

  Fly   951 GSAAALVAEPEGIWKEVKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNN-----TSSK 1010
                          .::||...|:...:..:|.||:|    ........|.|:.::     |..:
Human   249 --------------SKMKRSRPTSEGSDIESTEPQKQ----CSKKKKKRDRVEASSLPEVRTGKR 295

  Fly  1011 SKSSSNNAPSNASSSATVCVTTNN----ASSATKATT------------KTTTTSTATTTTNNNI 1059
            .:|||.:|.|.|..|....:...:    ||.|:|...            :....||.......::
Human   296 KRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKENRAPCLNGELFYLFQDIEISTEEEKDTGDL 360

  Fly  1060 KSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPL 1104
            |  :::..||..|...|         |.|:.::    .||:: ||
Human   361 K--DSSLLKTKRKHKKK---------HKERHKM----GEEVI-PL 389

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 28/73 (38%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP7NP_001357903.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.