DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and RGD1565989

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001102652.1 Gene:RGD1565989 RGDID:1565989 Length:274 Species:Rattus norvegicus

Alignment Length:286 Identity:145/287 (51%)
Similarity:174/287 (61%) Gaps:49/287 (17%)


  Fly  1290 LDTVEHRPRTTSMGSSAGTSPT--ASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHS 1352
            :|:.:|.||..|: ||:..||:  |...||. |.:|||.|.|:||||.|||||.||||.|.||..
  Rat     1 MDSRDHGPRPPSV-SSSNVSPSEAAPLTGSC-SCMPQSFPKFEHPSHELLKENGFTQQVYQKYRR 63

  Fly  1353 RCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSY 1417
            |||.||:|||.|||||||||:|||||||||:||:.||.|||.||.|||...:||||||||||:||
  Rat    64 RCLSERKRLGIGQSQEMNTLFRFWSFFLREHFNRKMYEEFRQLAWEDAKENYRYGLECLFRFYSY 128

  Fly  1418 GLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDF 1482
            |||||||..|::|||:||..|||:|||||||||||:|| |...:...|.|||.|||.|||.:|||
  Rat   129 GLEKKFRQEIFKDFQEETKKDYESGQLYGLEKFWAYLK-YSQSKTQSVDPKLQEYLCSFKKLEDF 192

  Fly  1483 RVVEPEINEMLQGVGSLNPGRQLNRHRSVSESDG-------------TAVIAAGGRRL------- 1527
            ||..|...|.         ||:  ||.|.|..:.             :|...|..|.|       
  Rat   193 RVDPPTSEEF---------GRK--RHPSTSGEESSHHTLPSHCSTPPSAAEPASARELQSQQGCA 246

  Fly  1528 -------------NTTITNRSDYVGR 1540
                         :|.:|:|.:..|:
  Rat   247 GERHRSPVTIHSDSTALTSRGEVPGK 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 27/38 (71%)
RGD1565989NP_001102652.1 DM15 53..93 CDD:128927 32/40 (80%)
DM15 94..132 CDD:128927 27/38 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.