DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp6

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_012825802.1 Gene:larp6 XenbaseID:XB-GENE-493801 Length:769 Species:Xenopus tropicalis

Alignment Length:531 Identity:114/532 (21%)
Similarity:187/532 (35%) Gaps:163/532 (31%)


  Fly   663 GRGGFSRQGPGRPTYRIPRH-------------------LLASGEYANYLPADAAGADSQSSYVL 708
            |.|.|    ||...|.|..|                   |:.:|:.:.   .|:|..|..|....
 Frog   297 GFGTF----PGIECYGIGNHLGQIIINPESAENEDQEKGLMEAGDCSE---DDSARQDKYSGAAT 354

  Fly   709 MGTHYFGNVPAAYIEL-------DANSIKEAIKKQVEYYFSVDNLTGDFFL-----RRKMDPEGY 761
            .|....|:      ||       ||..|::.| .|:|||.|.:||..|.||     |.||   |:
 Frog   355 SGGENDGD------ELDQDWKPPDAELIQKLI-TQIEYYLSDENLEKDAFLLKHVRRNKM---GF 409

  Fly   762 IPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE-GYKVRTKTTPTTWP-------------I 812
            :.|.|:.||.:|..||.|......|::.|:.|||.| ..|:|.||....:|             :
 Frog   410 VSVKLLTSFKKVKHLTRDWRTTAYALRYSNLLELNEDNRKIRRKTPVPVFPSENLPSKMLLVYDL 474

  Fly   813 TEVPEVNEGEPKAIGTLEQEQLEQNDG-QEK-LEEQTEADSPPPILTSAMATKPLNSIPPPPMPR 875
            ..:||:|        .|.:||  :|.| ||| :|...::.....:::|....||...:|      
 Frog   475 HFIPELN--------CLGKEQ--ENGGMQEKVMEHLLKSFGTFGVISSIRILKPGRDLP------ 523

  Fly   876 NPQNLVPKMLQDKQQ--SRSSTI--------------AALNSVNAISALTQQVEGGAAELAGHLS 924
                      .|.::  ||.|.:              ||:.:.:..:..:...:|....|.|   
 Frog   524 ----------SDVKRFSSRYSQVGTKDCAIVEFEEVEAAIKAHDTFNVESDTEDGLKVVLIG--- 575

  Fly   925 GLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKE-----NATTPP 984
                ...||.....||.....:.|..                 |.:|....::|     :.:|..
 Frog   576 ----MKPPKKKIQKDKSKEEDSKNVR-----------------KNKSLNKRVEELQYIGDESTVY 619

  Fly   985 QQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSS----ATVC----------VTTNNA 1035
            ...:|..:.|.......:::.|..|.|...:|:...|||..    ::.|          :..:.:
 Frog   620 SSSEPDSNPTSPMVGRKIQSTNKLSPSAYPNNHLSPNASPRNSPWSSPCGQRKGVKHSPLADSMS 684

  Fly  1036 SSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEEL 1100
            ...::..|:.::.|:.|.:::..::....|.:.|..||      |..:.....|        .:.
 Frog   685 PEISRKCTEYSSDSSITPSSSPWVQRRRQAQTVTQEKS------PVGSPMLGRK--------IQN 735

  Fly  1101 MDPLPPGTGRI 1111
            .|.||||..|:
 Frog   736 ADGLPPGVLRL 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 31/79 (39%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
larp6XP_012825802.1 LARP_6 376..452 CDD:153402 32/80 (40%)
RRM_LARP6 467..575 CDD:240735 24/134 (18%)
SUZ-C 743..757 CDD:289656 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121289427
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.