DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp7

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_524795.2 Gene:Larp7 FlyBaseID:FBgn0260771 Length:595 Species:Drosophila melanogaster

Alignment Length:430 Identity:84/431 (19%)
Similarity:147/431 (34%) Gaps:112/431 (26%)


  Fly   732 AIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELF 796
            :|:.|:|:||...||:.|.||||.::.:.|:|:.:..:|:::..||.||..|..|:..|..|||.
  Fly    62 SIRGQMEFYFGDANLSKDRFLRRYVEQDPYVPLEIFLTFNKIKTLTQDVQQIAKALSNSQLLELD 126

  Fly   797 E-GYKVRTKTTPTTWPITEVPEVNEGEPKAI---------------------GTLEQEQLEQNDG 839
            | ..||:.:        |::|:..:...|.:                     |.:....|....|
  Fly   127 ETELKVKRR--------TKLPDQRDVNDKTLYVEALPANATHDWLKEVFSRYGPVAYVSLPHYPG 183

  Fly   840 QEKLEE--------------------------QTEADSPPPILTSAMATKPLNSI---PPPPMPR 875
            .:|::|                          ..|.|  |..|.|..:.:....|   ...|...
  Fly   184 TKKIKEFAFIEFEKSGSLEKAVKAFAQIQGVLSVETD--PSDLASVRSFQQQQQIQQKAEQPQSE 246

  Fly   876 NPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAE--LAGHLSGLAESVKPKSTSTP 938
            ..|..:||    :...|.:|......::.:..:..: ||..:|  .||..:...::......|..
  Fly   247 AEQVELPK----RNLKREATDKDREEIHEVKRVKLE-EGQPSETSTAGETASETDAEGTAEASEQ 306

  Fly   939 DKRNAASAGNGAG--------------------SAAALVAEPEGIWKEVKRR-----------SK 972
            :.:..|:.|:.|.                    ||..|...|:..|..::.:           :|
  Fly   307 EDKTEATDGDEAAKKRRRKRKKKAIVDKPNIEPSALELKVLPKTSWSSMRNKYLNLQRRIVSEAK 371

  Fly   973 TNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASS 1037
            :...:||  .|..||.|...||.:.|:........:.|.:.:....||:....|......  .:.
  Fly   372 SKLWREN--HPQNQQHPHHQQTSHPNHPKPSQLPEAVKEEETGGEVPSDGGEGAVEAAPV--PAK 432

  Fly  1038 ATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKT 1077
            ..||..|...         |...:|....:|:...|..:|
  Fly   433 RRKAVHKMNM---------NFYGAGGVESTKSEEPSQERT 463

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 28/72 (39%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp7NP_524795.2 LA 57..135 CDD:128955 28/73 (38%)
RRM <116..>208 CDD:223796 16/100 (16%)
RRM1_LARP7 148..>209 CDD:240736 5/61 (8%)
RRM2_LARP7 471..548 CDD:240986
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121249577
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22792
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.