DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and ssb

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001001455.1 Gene:ssb XenbaseID:XB-GENE-491374 Length:426 Species:Xenopus tropicalis

Alignment Length:356 Identity:77/357 (22%)
Similarity:133/357 (37%) Gaps:107/357 (30%)


  Fly   722 IELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRK--MDPEGYIPVTLIASFHRVLALTTDVAVIV 784
            ::||..     |.:||||||...||..|.||.::  :| :|::|:..:..|:|:..||.|...|:
 Frog    11 LDLDTK-----ICEQVEYYFGDHNLPRDKFLNQQILLD-DGWVPLETMIKFNRLSKLTKDFNTIL 69

  Fly   785 NAIKESDKLELFE----GYKVRTKTTPTTWPITEVPEVNE--------------GEP-------- 823
            .|:|:| |.||.|    ..|:|..      |...:||:|:              |.|        
 Frog    70 QALKQS-KTELLEIDEDKCKIRRS------PAKPLPELNDEYKNSLKNKSVYIKGFPTSANLDDI 127

  Fly   824 ----KAIGTLEQEQLE-----------------QNDGQEKLEEQTEA--DSPPPILTSA--MATK 863
                |..|.:|..|:.                 :::.::.||::...  ||...||:..  .|.|
 Frog   128 KEWLKDKGPIENIQMRRTLQKEFKGSIFLIFNTEDEAKKFLEDRNRKYNDSDMIILSKEEYFAKK 192

  Fly   864 PLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAE 928
                        |.:..:.|..:..:..:.:..|...:.:|...|.::..|...:.:|.|..:  
 Frog   193 ------------NQERKLNKSEEKAKSKQENEEAQKQAEDAERKLMEERVGRLLKFSGDLDNM-- 243

  Fly   929 SVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAI--KENATTPPQQQQPPL 991
                  ||..|            .:|...|..:..|.:..|.:|...:  |.||       :..|
 Frog   244 ------TSRED------------LSALFQAHGDIEWIDFSRGAKEGIVLFKMNA-------KKAL 283

  Fly   992 SQTLNNNNDNVKTNNTSSKSKSSSNNAPSNA 1022
            .:.:..|||::|....:.|.:....:|...|
 Frog   284 DKAMAANNDDLKLKGKAVKWELIEGDAEKEA 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 30/79 (38%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
ssbNP_001001455.1 LARP_3 12..91 CDD:153397 32/86 (37%)
RRM1_La 112..183 CDD:240737 11/71 (15%)
RRM_SF 231..332 CDD:327398 22/112 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.