DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and faxdc2

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_998672.1 Gene:faxdc2 ZFINID:ZDB-GENE-040426-2907 Length:323 Species:Danio rerio

Alignment Length:56 Identity:13/57 (23%)
Similarity:21/57 (37%) Gaps:15/57 (26%)


  Fly  1134 NKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVV 1189
            |.||::..|...|         :|.:|.:|..|..:.::.|      .||.....|
Zfish    84 NALLMLVDVTGKP---------NFITRYRIQTDKNSPVDTG------RLWHAVKTV 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
faxdc2NP_998672.1 ERG3 <159..288 CDD:225546
FA_hydroxylase 164..288 CDD:282034
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.