DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment larp and faxdc2

DIOPT Version :10

Sequence 1:NP_733244.5 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_998672.1 Gene:faxdc2 / 406828 ZFINID:ZDB-GENE-040426-2907 Length:323 Species:Danio rerio


Alignment Length:56 Identity:13/56 - (23%)
Similarity:21/56 - (37%) Gaps:15/56 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1134 NKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVV 1189
            |.||::..|...|         :|.:|.:|..|..:.::.|      .||.....|
Zfish    84 NALLMLVDVTGKP---------NFITRYRIQTDKNSPVDTG------RLWHAVKTV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larpNP_733244.5 LARP_1_2 730..803 CDD:153403
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
faxdc2NP_998672.1 FA_hydroxylase 164..288 CDD:397991
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.