DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp4B

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_647793.1 Gene:Larp4B FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster

Alignment Length:1374 Identity:256/1375 (19%)
Similarity:414/1375 (30%) Gaps:499/1375 (36%)


  Fly   487 TNSQATTAPVASTSHDAKAQRDAEPAA---------NSAAGTTGTAAGPALTKKIPKHKWRPLPI 542
            ||....||.:|:....|..|..|.|||         .:||.....|..||:...:     ...|:
  Fly    24 TNVPVETAMLATNLFGATTQIAASPAAAAAAHIPLITAAAAAAAAAGAPAVAPPV-----AVAPV 83

  Fly   543 DLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGV--------ESRHPHAGRH-P 598
            ..|.:::...:..:..::.....|.......|.|.:|.......:        :.:.||..:| .
  Fly    84 ATASAAQAAVVPAQQQQQAHPHQAQILAHTHVAHQQQQQQQQQTIQQHLHQQQQQQSPHPAQHLT 148

  Fly   599 YGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQG 663
            ||.:||.:                       ...|||:|...                  ||..|
  Fly   149 YGHQPALS-----------------------QATAGGSGTIS------------------GGAVG 172

  Fly   664 RGGFSRQGPGRPTYRIPRHLLA---SGEYANY--------------------------------- 692
            ..|...:|.....|.|....|.   .|....|                                 
  Fly   173 PSGVVVEGQDTNEYAIMNGALGQTQDGTVVCYTTDALNNTNLVALDPQPHQIVVPVQVPVQVPVP 237

  Fly   693 --LPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRK 755
              |||:.:....|.|:...|    |..|  .|.||  .:|:.:..|:|||||.:||..|.:|..:
  Fly   238 VQLPANGSADPQQGSHNAAG----GEEP--NIPLD--KLKQMLATQLEYYFSRENLANDTYLLSQ 294

  Fly   756 MDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE-GYKVR---------TKTTPTTW 810
            ||.:.|:|:..:|.|:.|..||.|:.:|...::||..:::.: |.:||         .:......
  Fly   295 MDSDQYVPIYTVARFNLVRKLTNDINLITEVLRESPNVQVDDKGLRVRPNRKRCIIILREISNNT 359

  Fly   811 PITEVPEV--NEGEPKAIG-----------TLEQEQLEQNDGQEK---LEEQTEADSPPPILTSA 859
            |:.:|..:  ||..|:.|.           |.|.::    |.|:.   |.|:.:.....||:...
  Fly   360 PLDDVKALFSNESCPRPISCEFAANNSWYITFESDE----DAQKAYKYLREEVKEFQGKPIMARI 420

  Fly   860 MATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHL- 923
            .....:|.|...|               |...|.::....|..:...|....|...||:...:| 
  Fly   421 KPKSFINRIQAVP---------------KNGYRLTSPPTANVFDPAGAGGATVSYAAAQQPRYLY 470

  Fly   924 -SGLAESVKPKSTS------TPDKRNAASAGNGA-----GSAAALVAEPEGIWKEVKRRSKTNAI 976
             :|.|.:. |.|..      .|..:|....|..|     |:.||..|..:..::.......||.:
  Fly   471 TNGAAIAA-PASVQYSNPVLIPIPQNQFYPGLVAGPWPPGTVAATTAHGQNFYELGGNIFTTNPL 534

  Fly   977 KENATTPPQ-------QQQPPLSQTL----------NNNNDNVKTNNTSSKSKSSSNNAPSNASS 1024
                  |||       |..||.||.:          .|||.....||.     ..:|:.|     
  Fly   535 ------PPQPVTAGFAQAPPPTSQAMVTPKPQGGGRYNNNHRGNPNNV-----GGANSGP----- 583

  Fly  1025 SATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEK 1089
                     .|.|.:|....|.:.|        :|:.||....:.       ||..|........
  Fly   584 ---------RAESRSKPPRSTPSAS--------HIQGGNIMPIQI-------TAPIPGGMVSVVP 624

  Fly  1090 EELDFQFDEELMDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAPKHEGYDRT 1154
            ..:       :.|||.|                      |........::.|:.:.|......:.
  Fly   625 TNI-------VQDPLQP----------------------APLQQQPQQVIQQIQQQPSSSAQQQQ 660

  Fly  1155 ADFTSRTKITQDLENIINDGLVNYEEDLWTTTN--VVADYKTVNVISQADFEKLAGGRNKSVLPP 1217
            |       .|..:.|              ||.:  :.:::|              ||..|     
  Fly   661 A-------ATVQMNN--------------TTRHYPIKSNWK--------------GGMQK----- 685

  Fly  1218 QVVPPPPPFEEDLDETLVGDTTLNSTLNNTLKSRRARFYAAPNSHSIDPRTPRKRKLRHTANPPV 1282
                       :||::..|....:......:::..|      :||.:..:...:.:         
  Fly   686 -----------NLDKSYSGGVATHHHYTTQVQALPA------HSHHLQAQQQLQGQ--------- 724

  Fly  1283 EAHVGWLLDTVEHRPRTTSMGSSAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAY 1347
                     |.:...:..|  |||.::|..    ::.::.|......||..|.::::   ||...
  Fly   725 ---------TQQQHYQLAS--SSAASAPQV----TYVTTAPAPQQPGQHQHHLVVQQ---TQPQQ 771

  Fly  1348 HKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLF 1412
            .:...:.:.:::::   |.||                            |::||:|..:.     
  Fly   772 QQQQQQVVLQQQQV---QVQE----------------------------LQEAGDGVEHS----- 800

  Fly  1413 RFFSYGLEKKFRPNIYQDFQDETIA-------------------DYETGQLYGLEKFWAFLKYYK 1458
               |:.:::..|.:........::|                   |.|.|           :.|..
  Fly   801 ---SHAMQQVNRSSNMSASSSSSLATSMSKEPLQWQNRPRRRRRDEEGG-----------INYSP 851

  Fly  1459 NGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRHRSVSESDGTAVIAAG 1523
            .|       ::..|..|..|      ..|:.:.|....||        ..:|...:||......|
  Fly   852 GG-------RVGLYGSSPSN------PHPQQHLMSSSTGS--------NVQSAGGTDGGGASHRG 895

  Fly  1524 GRRLN--TTI------TNRSDYVGRLLQQQHQQQ-------------------QQQQHH----QY 1557
            |.|.:  .||      .:|.:|.|......:..|                   ||||||    ..
  Fly   896 GERQSHYNTIHDVPPPQHRGNYKGNNYNPHYHAQHSSMASGSHHHHHHNALSSQQQQHHLTTGTG 960

  Fly  1558 QQGYG-GYNQQQNRRRTGS--FGSTTVRIRSGSLGNKPQVANRNQGSQHELRRGGSNS------- 1612
            |||.| .|:...:....||  ..|..:.:.||..|.    .....||......||||.       
  Fly   961 QQGSGHHYHHHHHHNSIGSNVGNSGGLGVSSGGSGG----GGSGGGSGSNSLSGGSNERGIHHSS 1021

  Fly  1613 -GLAPH---------KRQQQQKPKPGAGSQ-------------TGSTRATTSAAATATTAASAAT 1654
             |...|         ::||||:.:|.|..|             ..:|.||......||..||...
  Fly  1022 LGYQGHQHQHQQQQQQQQQQQQQQPAAPVQPPQFDLEDAAFPPLPATSATAPHTPQATGGASLHN 1086

  Fly  1655 STAATPAVT 1663
            ||.::.:.|
  Fly  1087 STTSSSSST 1095

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/83 (33%)
DM15 1341..1382 CDD:128927 5/41 (12%)
DM15 1383..1421 CDD:128927 5/38 (13%)
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 27/74 (36%)
RRM_LARP4_5_like 348..423 CDD:240876 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121029814
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22792
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.