DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Achl

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001286419.1 Gene:Achl FlyBaseID:FBgn0033936 Length:867 Species:Drosophila melanogaster

Alignment Length:596 Identity:124/597 (21%)
Similarity:196/597 (33%) Gaps:202/597 (34%)


  Fly   724 LDANSIKEAIKKQVEYYFSVDNLTGDFFLRR--KMDPEGYIPVTLIASFHRVLALTTDVAVIVNA 786
            :.:..:...|...||:|||.:::..|.||.:  :.:.||::.:.|::||.||..||.:..|:.:|
  Fly   276 IPSEELAAEITDAVEFYFSNESILKDAFLLKHVRRNKEGFVSLKLVSSFKRVRQLTREWKVVGDA 340

  Fly   787 I-KESDKLELFE-GYKVRTKTTPTTWPITEVPEVNEGEPK---AIGTLEQEQLEQNDGQEKLEEQ 846
            : ::|.|:||.: |.|||.        |..:|..:|..|.   ....|..::|       .:|:.
  Fly   341 VRRKSRKIELNDVGTKVRR--------IEPLPSFDETMPSRTIVACDLPLDKL-------TIEKV 390

  Fly   847 TEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQ 911
            ::..||...:......||..:||..  .|...|..|: ||.|:                .||.:.
  Fly   391 SDLFSPCGEIALIRILKPGMAIPVD--VRQFMNKYPE-LQQKE----------------CALVEY 436

  Fly   912 VEGGAAELAGHLSG---LAESVKPKS--------------------------------------- 934
            :|..:|..|.||:|   :.|.|.||.                                       
  Fly   437 LESSSARDARHLNGPFQVYEMVAPKKKTGKKAAVIQIAAPVARMVENYRYYNDANYERSRGGSFS 501

  Fly   935 --TSTPD-----KRN--------------------------AASAGNGAGSAAALVAEPEGIWKE 966
              .:.||     |||                          ..|.||......     |.|.:..
  Fly   502 GHETVPDLRFKLKRNNSDFQPSYYQQTGPSYHANPYQHYQPRGSIGNQNQEVG-----PNGFFGY 561

  Fly   967 VKRR-SKTNAIKENATTPPQQQQPPLSQTLNNNND--------------NVKTNNTSSKSKSSSN 1016
            ..|| |.|:.|..| |........|:|..:|:..:              |....|.:.:...|.:
  Fly   562 GPRRYSNTSTISAN-TAAALGDVSPISSAVNSGGNPMVSGISSLQRRLSNCSEQNYTPEVNPSMS 625

  Fly  1017 NAPSNASSSATV-----------CVTTNNASSATKAT----TKTTTTSTATTTTNN-----NIKS 1061
            ...||.|.:..|           |..:...|...:.|    .||:..|..:...||     ...:
  Fly   626 RRASNCSETGGVPQRRDSNCSESCPCSRRVSDFAQTTDTSYRKTSVCSNGSCPGNNQNQERRFSN 690

  Fly  1062 GNAAYSKTHSKSSSKTA--APPSAQCHAEKEELDFQFDEELMDPLPPGTG---------RINNF- 1114
            |:..:.:|.|.:|..:.  ..||...:.|:|.:.       .|.|..|.|         ..||| 
  Fly   691 GSMQFERTFSNASESSGFYRRPSNDFNIEREPIQ-------TDQLVGGGGGGYQVWPRRYSNNFQ 748

  Fly  1115 --TENFSDDDESDYEFADRDINKLLIVAQVG--RAPKHEGYDRTADFTS-------RTKITQDLE 1168
              :...:..|.:.|               :|  |.....||||...|.|       |::....|.
  Fly   749 QLSSKLAAYDNAQY---------------IGGRRISTDSGYDRRCSFGSEGFEGSPRSRTGSFLS 798

  Fly  1169 NIINDGLVNYE 1179
            |..:.|...|:
  Fly   799 NYKHGGGDGYD 809

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 28/77 (36%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
AchlNP_001286419.1 LARP_6 282..359 CDD:153402 28/77 (36%)
RRM_LARP6 373..472 CDD:240735 27/125 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121311209
eggNOG 1 0.900 E1_COG5193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22792
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.