DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and La

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_477014.1 Gene:La FlyBaseID:FBgn0011638 Length:390 Species:Drosophila melanogaster

Alignment Length:419 Identity:87/420 (21%)
Similarity:155/420 (37%) Gaps:132/420 (31%)


  Fly   730 KEAIKKQVEYYFSVDNLTGDFFLRRKM--DPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDK 792
            :.||.:||||||...||..|.|||.::  :.:|::|::::.:|.|:.:|:||::.||.|:.:|::
  Fly    51 ERAIIRQVEYYFGDANLNRDKFLREQIGKNEDGWVPLSVLVTFKRLASLSTDLSEIVAALNKSEE 115

  Fly   793 --LELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPI 855
              :|:.|     .|.:....|...:||.||                 :.:::::|:|......|:
  Fly   116 GLVEISE-----DKLSLRRHPERPIPEHNE-----------------ERRKEIQERTAYAKGFPL 158

  Fly   856 LTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELA 920
                                           |.|.|.....||  :.:.:..||         :.
  Fly   159 -------------------------------DSQISELLDFAA--NYDKVVNLT---------MR 181

  Fly   921 GHLSGLAESVKPKST-----STPDKRNAASAGNGAGSAAALVAEPEGIWK--EVKRRSKTNAIKE 978
            .|.....:|.|.|.:     .|.|:            |.|.:.:.:.::|  |:.|:.:.:.:||
  Fly   182 KHYDKPTKSYKFKGSIFLTFETKDQ------------AKAFLEQEKIVYKERELLRKWQVDYLKE 234

  Fly   979 NATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATT 1043
            ......|:              |.|..|........:...|.||.........|::.....:|..
  Fly   235 KQEEYAQK--------------NEKRKNKKEAKPEPAFELPKNAIVVFEGAPETSSREEIREAFE 285

  Fly  1044 KTTTTSTATTTTNNNIKSGNAAY---SKTHSKSSSK-TAAPPSAQCHAEKEELDFQFDEELMDPL 1104
            |              ||....||   :|..:|.|.: |.|..:.:..|:.||...:|.:|:...|
  Fly   286 K--------------IKDFEVAYIEFAKGETKGSVRLTEADAAEKYIAKVEEGKLKFKDEVSLSL 336

  Fly  1105 PPGTGRINNFTENFSDDDESDYEFADRDI 1133
            ...|             :|.:.||.|:.|
  Fly   337 RKAT-------------EEEEKEFIDKAI 352

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/77 (35%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LaNP_477014.1 LARP_3 47..129 CDD:153397 28/83 (34%)
RRM1_La 150..226 CDD:240737 20/130 (15%)
RRM_SF 263..338 CDD:302621 20/89 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121219835
eggNOG 1 0.900 E1_COG5193
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22792
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.