DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp6a

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_956197.1 Gene:larp6a ZFINID:ZDB-GENE-030131-6403 Length:485 Species:Danio rerio

Alignment Length:453 Identity:103/454 (23%)
Similarity:173/454 (38%) Gaps:121/454 (27%)


  Fly   723 ELDANSIK----EAIKK---QVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLA 775
            ||:..|.:    |.|:|   |:|||.|.:||..|.||     |.|:   |::.|.|:.||.:|..
Zfish    65 ELEEESWQPPDPELIQKLVAQIEYYLSDENLEHDAFLLKHVRRNKL---GFVSVKLLTSFKKVKH 126

  Fly   776 LTTDVAVIVNAIKESDKLEL-FEGYKVRTKTTPTTWPITEVPE----VNEGE--PK---AIGTLE 830
            ||.|......|::.|:.||| .||.|||.::|...:....:|.    ::|.:  |:   |:|.  
Zfish   127 LTRDWRTTAYALRHSNLLELNDEGRKVRRRSTVPVFASESLPSRMLLLSELKRWPELGIALGG-- 189

  Fly   831 QEQLEQNDG-----QEKLEEQTEADSPPPILTSAMAT-KPLNSI----PPPPMPRNPQNLVPKML 885
                :.|:|     ||:|.|         :|..|... .|:.|:    |...:|.:.:.|..:..
Zfish   190 ----DSNNGSGPTQQERLME---------LLLKAFGNYGPIASVRVLKPGKDLPADLKKLSGRYS 241

  Fly   886 QDKQQSRSSTIAALNSVNAISALTQQV--EGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGN 948
            |  ..:....|.....|.|.....:.|  |||.....| |..:....||.....|..|       
Zfish   242 Q--LGTEECAIVEFEEVEAAMKAHEAVGGEGGNRGPLG-LKVVLIGTKPPKKKVPKDR------- 296

  Fly   949 GAGSAAALVAEPEGIWKEVKRRSKTNAIKE-------NATTPPQQQQPPLSQTLNNNNDNVKTNN 1006
                     ...|||....|.||..:.::|       :|.:..:.:..|.|..|           
Zfish   297 ---------PRDEGIGGMRKSRSLNSRVRELQYHGDDSAASSSETESNPTSPRL----------- 341

  Fly  1007 TSSKSKSSSNNAPSNASSSATVCVTTNNAS-----SATKATTKTTTTS----------------- 1049
             :.||:|.:..:|::|..:....|.:..:|     .|:..|.:.|..|                 
Zfish   342 -ARKSRSCNKLSPTSAGPNHLSPVVSPRSSPWSSPRASPCTQRKTHPSGKSPLASEGRLSPEPGR 405

  Fly  1050 -TATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRI 1111
             .|..::::::....:.:.:...:.:|:.::|..:...|.|        .:..|.||||..|:
Zfish   406 RWADYSSDSSLTPSGSPWVQRRKQVASQESSPVGSPMLARK--------IQNADGLPPGVVRL 460

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 34/86 (40%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
larp6aNP_956197.1 LARP_6 79..155 CDD:153402 33/79 (42%)
RRM_LARP6 200..284 CDD:240735 21/96 (22%)
SUZ-C 457..472 CDD:289656 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121277162
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.