DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_021324942.1 Gene:larp1 ZFINID:ZDB-GENE-030131-5386 Length:993 Species:Danio rerio

Alignment Length:1327 Identity:404/1328 (30%)
Similarity:569/1328 (43%) Gaps:418/1328 (31%)


  Fly   283 TSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGATTTTQTTTAAAAAATA 347
            |.|.:..:|||  ::.|.:..:...|..:..::.|....|::|                      
Zfish     7 TLPPNNPLLQP--EEPQHKDGEYPLQERHTADSGSPGAGQEEQ---------------------- 47

  Fly   348 AAAATAATTSAAAATSSAAAVPAATTETATTTTVD---ASQADALAKVVVKDKKKVNQ--KASDF 407
                      ||....|.|.:|.....|...:.|:   |::.....|||.....::.:  |..||
Zfish    48 ----------AAGREISEAPLPKVNPWTKKMSGVNGQPAAEHSGPTKVVKAGNSRLRRGGKVGDF 102

  Fly   408 SNVGDWPTLIGGTSGSGKATSNE--------PKRNPTKKQQSAKTAAAVAASSNTTSSEVATESN 464
            .:..:|||       .|:..:.|        .||.|..|::|.::...:.:.|:.:..:      
Zfish   103 GDTNNWPT-------PGEIATKEVQVLKKPTVKREPKGKRESEESKENLKSKSDDSGED------ 154

  Fly   465 VAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALT 529
                              .||...||       .:||..:..                       
Zfish   155 ------------------KNTDEESQ-------RSSHRRRGN----------------------- 171

  Fly   530 KKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHA 594
                |.:|.||.|:: |:..|:......|         ..||    :|...|.          |:
Zfish   172 ----KQRWVPLMIEV-KAEGPRERSASRN---------NTRP----YDAHRGT----------HS 208

  Fly   595 GRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRG 659
            .|:.....|    |||.:......      .||..|..:.||                   |||.
Zfish   209 SRNGLRDWP----SERFEQELKDD------HDEVSSVKSDGA-------------------PYRA 244

  Fly   660 GRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADS--QSSYVLMGTHYFGNVPAAYI 722
            |.:|||....:|.||...|        |.|..|....:.|.|.  ...:....|:|:.|:.:|.:
Zfish   245 GARGRGRGRGRGRGRGRGR--------GHYDYYSYKGSEGKDGAYAQKFGNSMTYYYDNMSSAEL 301

  Fly   723 -ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNA 786
             .:|.:.:|:.||:|:|||||||||..|||||||||..|::||:||||||||.||||||::|:.|
Zfish   302 YSVDQDLLKDYIKRQIEYYFSVDNLERDFFLRRKMDEGGFLPVSLIASFHRVQALTTDVSLILQA 366

  Fly   787 IKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADS 851
            :|:|..:::.: .|:|.|..|..||:.::                          .|.:|.:.|.
Zfish   367 LKDSKVVDIID-MKMRCKEEPQKWPLPDL--------------------------CLPDQAQTDF 404

  Fly   852 PPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGA 916
            ...|.......:.|.:.|.|                                             
Zfish   405 AQFIHCPEFIPRHLPASPSP--------------------------------------------- 424

  Fly   917 AELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKENAT 981
                   :|...|..|:| |||.:...:......|.:|:|.......|.|||:|.:         
Zfish   425 -------AGTPRSGTPRS-STPHQELCSLKMMPKGLSASLPDLDSECWIEVKKRPR--------- 472

  Fly   982 TPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATTKTT 1046
              |...:|        ..::|:                         ||                
Zfish   473 --PSPARP--------KKEDVR-------------------------CV---------------- 486

  Fly  1047 TTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEEL--MDPLPPGTG 1109
                        ::.|..                 ||:...|.|||||.||||:  ||      |
Zfish   487 ------------LQMGQV-----------------SAEEQEEPEELDFMFDEEMQQMD------G 516

  Fly  1110 RINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAP---KHEGYDRTADFTSRTKITQDLENII 1171
            |.|.||: :||:| ||.|..|||:||:|||.|.  .|   ||.|.|||...|||:|::.:|..||
Zfish   517 RRNTFTD-WSDED-SDCEIDDRDVNKILIVTQT--PPYLRKHPGGDRTGHHTSRSKLSSELVKII 577

  Fly  1172 NDGLVNYEEDLWTTT---------NVVADYKTVNVISQADFEKLAGGRNKSVLPPQVVPPPPPF- 1226
            ||||..||:|||..:         ..|.::|.|::||:..|:.|.  ....|.|.|.|||.||. 
Zfish   578 NDGLFYYEQDLWDDSGEPEYAIIKQEVENFKKVHLISREQFDCLT--PEPPVDPNQEVPPGPPRP 640

  Fly  1227 ----------EEDLDETLVG-------DTTLNSTLNNTLKSRRA-----------------RFY- 1256
                      .|.|...|.|       ..:|.:|:.::...|.|                 ||| 
Zfish   641 TQSKIHTLFPTEALANKLFGAPDPSCMARSLPTTVPDSPSHRSARTPRTPRTPRLKDAQTPRFYP 705

  Fly  1257 AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTASSYGSFGSS 1321
            ...:...:|.:||||||.||::|||:|.||||::|:.|||.||.|:.|:|..|...::.|:||.:
Zfish   706 VVKDGRPLDAKTPRKRKTRHSSNPPMECHVGWVMDSREHRSRTASVSSNASPSEGTAAMGNFGCT 770

  Fly  1322 VPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNK 1386
             |||||.||||||.|||||.|||..||||..|||.||:|||.|||||||||:||||||||::||:
Zfish   771 -PQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNR 834

  Fly  1387 SMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFW 1451
            .||.|||.|::||...|:||||||||||:|||||:||||:|::|||:||:.|||.||||||||||
Zfish   835 KMYEEFRQLSVEDGKEGYRYGLECLFRFYSYGLERKFRPDIFKDFQEETVKDYEAGQLYGLEKFW 899

  Fly  1452 AFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSLNPGRQLNRH------RS 1510
            |||||.|. :.:|::|||.|:|..|:.:|||||..|..:.:.:...|...||:  ||      ||
Zfish   900 AFLKYSKT-KNMEIEPKLQEHLSKFRRLEDFRVDPPMEDGVRKRHSSSGDGRR--RHPSHPGSRS 961

  Fly  1511 VSESD-GTAVIAAGGRRLNTTITNRSD 1536
            .::|. ..:..|||..|.::...::.|
Zfish   962 QTQSQLQPSGAAAGATRDDSRAQSQRD 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 45/73 (62%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 26/38 (68%)
larp1XP_021324942.1 LARP_1 310..382 CDD:153406 45/73 (62%)
DM15 790..830 CDD:128927 32/40 (80%)
DM15 831..869 CDD:128927 26/38 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 552 1.000 Inparanoid score I1073
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T597272
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.