DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp6

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001101624.1 Gene:Larp6 RGDID:1308414 Length:492 Species:Rattus norvegicus

Alignment Length:516 Identity:106/517 (21%)
Similarity:174/517 (34%) Gaps:133/517 (26%)


  Fly   603 PATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRGGF 667
            |.|....||....:.........||..|..|.|..|             ||.:|      |.|..
  Rat    12 PETTVQIRVAIQEAEDVEDLEEDDEGTSARAAGDTA-------------RYLSP------GWGSA 57

  Fly   668 SRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEA 732
            |.:.|.|                .:..|..:|.::...          ::...:...|...|::.
  Rat    58 SEEEPSR----------------GHSSATTSGGENDRE----------DLEPEWKPPDEELIRKL 96

  Fly   733 IKKQVEYYFSVDNLTGDFFL-----RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDK 792
            : .|:|:|||.:||..|.||     |.|:   ||:.|.|:.||.:|..||.|.....:|:|.|..
  Rat    97 V-DQIEFYFSDENLEKDAFLLKHVRRNKL---GYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVT 157

  Fly   793 LELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILT 857
            |||.|.::...:|||.  |:..    ||..|..:..:....|.                  |.|.
  Rat   158 LELNEDHRKVRRTTPV--PLFP----NENLPSKMLLVYDLHLS------------------PKLW 198

  Fly   858 SAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGH 922
            | :||.|.|.       |..:.::..:|:     ...|...::||..:                 
  Rat   199 S-LATPPKNG-------RVQEKVMEYLLK-----LFGTFGVISSVRIL----------------- 233

  Fly   923 LSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRR---SKTNAIKENATTPP 984
                    ||.....||.|..:|..:..|:....:.|.|.:...:|..   :..:..|||.....
  Rat   234 --------KPGRELPPDIRRISSRYSQVGTQECAIVEFEEVDAAIKAHEFMATESQGKENMKAVL 290

  Fly   985 QQQQPPLSQTL--NNNNDNVKTNNTSSKSKSS--------SNNAPSNASSSATVCVTTNNASSAT 1039
            ...:||..:.|  .|:.|........|:|.:.        .:.:.:|:||......|:..|....
  Rat   291 IGMRPPKKKPLKDKNHEDEPAAGTRLSRSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRH 355

  Fly  1040 KATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEEL 1100
            .|:.|.:.:.......:.|....::.:|...::....:...|.    ||:..|:|....|:
  Rat   356 VASNKLSPSGHQNIFLSPNASPCSSPWSSPLAQRKGVSRKSPL----AEEGRLNFSTSPEI 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 29/78 (37%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp6NP_001101624.1 LARP_6 93..169 CDD:153402 30/80 (38%)
RRM_LARP6 184..292 CDD:240735 26/164 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121291664
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.