DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp4b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001100831.1 Gene:Larp4b RGDID:1310713 Length:738 Species:Rattus norvegicus

Alignment Length:754 Identity:149/755 (20%)
Similarity:235/755 (31%) Gaps:264/755 (35%)


  Fly   586 GVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGA-AGG-------AGAAGTG 642
            |.:|.|...|       |.:.|:.:..|..:.:...|....|....| ..|       |.:|..|
  Rat    21 GKDSSHLMNG-------PISQTTSQTSSLPALTQVPTTKVSELNPNAKVWGTHMLHLEASSAAVG 78

  Fly   643 VGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGE----YANYLPADAAGADSQ 703
            |.::.                     .:.|||||....:...|:|:    ..|....||..|:..
  Rat    79 VNASW---------------------EEAPGRPTDCDQQGSDANGDGDKSRENAALPDAQEAEQT 122

  Fly   704 SSYVLMGTHYFGNVPAAYIELDANS--------------IKEAIKKQVEYYFSVDNLTGDFFLRR 754
            ....|...|      |.|..|..||              .:|.:||.:|:..|.:||..|.:|..
  Rat   123 DMSTLALDH------AEYEPLPENSDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLIS 181

  Fly   755 KMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE-GYKVR---------TKTTPTT 809
            :||.:.|:|:|.:|:...:..|:|||.:||..::....:::.| |.|||         .:....:
  Rat   182 QMDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLVQVDEKGEKVRPNQNRCIVILREISES 246

  Fly   810 WPITEVPEVNEGE--PKAIG-----------TLEQEQLEQNDGQEK---LEEQTEADSPPPILTS 858
            .|:.||..:.:|:  ||.|.           |.|.|.    |.|:.   |.|:.......||...
  Rat   247 TPVEEVEALFKGDNLPKFINCEFAYNDNWFITFETEA----DAQQAYKYLREEVRTFQGKPIKAR 307

  Fly   859 AMATK-------PLNSIPP-----------------PPMPRNPQNLVPKMLQDKQQSRSSTIAAL 899
            ..|..       |.|...|                 ||: .:||...|.......|:.|:|.:.|
  Rat   308 IKAKAIAINTFLPKNGFRPLDMNLYTQQRYATSFYLPPV-YSPQQQFPLYSLIAPQTWSTTHSYL 371

  Fly   900 N-----------------------SVNAISALTQQVEGGAAELAGHL----------SGLAESVK 931
            :                       :.:.:::|.|...........||          .||.||  
  Rat   372 DPPLVTPFPSTGFINGFTSPTFKPATSPLTSLRQYPPRSRNPSKSHLRHAIPSTERGPGLLES-- 434

  Fly   932 P-----------KSTSTPDKRNAASA---------------GNGAGSAAALVAEPEGIWK----- 965
            |           ....:|..|.|...               |.|....::|.:.| |:.:     
  Rat   435 PSIFNFTADRLINGVRSPQTRQAGQTRTRIQNPSAYAKREIGTGRVEPSSLESSP-GLGRGRKNS 498

  Fly   966 ---EVKRRSKTNAIKENATTPPQQQQPPLSQTLNN------NNDNVKTNNT-----------SSK 1010
               ..||..|..:.:..:.|||:...|.....|:|      ...|:|..:.           |||
  Rat   499 FGYRKKREEKFTSSQTQSPTPPKPPSPSFELGLSNFPPLPGAAGNLKAEDLFENRLSSLIIGSSK 563

  Fly  1011 SKSSSNNAPSNAS--------SSATVCVTT----------------NNASSATKATTKTTTTSTA 1051
            .:|.|.:|.:|.:        |....|..:                ..|....:|.:.....||.
  Rat   564 ERSLSTDASTNTAPVVVPREPSVPAPCAVSAAFERSPSPAHLPEDHKVAEKQREAHSVDRLPSTP 628

  Fly  1052 TTTTNNNIKSGNAA-------YSKTHSKS-----SSKTAAPPSAQ------CHAEKEEL------ 1092
            |.|...:::...||       |::...::     ||....||..|      |..|:::|      
  Rat   629 TATACKSVQVNGAATELRKPSYAEICQRTSKEPPSSSPLQPPKEQKPNTVACGKEEKKLAEPAER 693

  Fly  1093 --------------DFQFDEELMDPLPPGTGRINNFTEN 1117
                          ..|..:....|.||..|:..|..:|
  Rat   694 YREPPALKSTPGVPKDQRRQPGRRPSPPAAGKRLNREQN 732

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/83 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp4bNP_001100831.1 LARP_5 157..231 CDD:153405 26/74 (35%)
RRM_SF 236..312 CDD:302621 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121327663
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.