DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_017453124.1 Gene:Larp1 RGDID:1306683 Length:1074 Species:Rattus norvegicus

Alignment Length:1487 Identity:449/1488 (30%)
Similarity:593/1488 (40%) Gaps:518/1488 (35%)


  Fly   134 ARKEKPRDQQPAGGRGDGQKPQQAGGRRV------PGSSDTERKSVRPRAPRGGSPRKSAAGAAG 192
            |||:...:.:|: |.|||......|.||.      ||...|||:|    .||   |..:|...||
  Rat    24 ARKKPAPEPRPSXGPGDGGGEPDGGVRRPRPACARPGRDGTERES----PPR---PPAAAEAPAG 81

  Fly   193 AAGSNAGAVSSAVPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGDQQAGEKGAAGAAPPPKR 257
            :.|.:.|               |:|                                        
  Rat    82 SDGEDGG---------------RRD---------------------------------------- 91

  Fly   258 FIAAPPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQ 322
            |:.|||||||.|...|....|...|..|                                     
  Rat    92 FVEAPPPKVNPWTKHAPPPPSAVNGQPP------------------------------------- 119

  Fly   323 QQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQAD 387
                |:                           .||.|....|||                    
  Rat   120 ----PE---------------------------PSAPAKVVRAAA-------------------- 133

  Fly   388 ALAKVVVKDKKKVNQKASDFSNVGDWPT--LIGGTSGSGKATSNEPKRN-PTKKQQSAKTAAAVA 449
                    .|::...|..||.:..:|||  .|...|...::...:|.|. |.||..         
  Rat   134 --------PKQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQPARKLPPKKDM--------- 181

  Fly   450 ASSNTTSSEVATESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAAN 514
                        :....|..|.|..:|.:.:..:....|.            |...||..:    
  Rat   182 ------------KEQEKGDGSDSKESPKTKSDESGEEKNG------------DEDCQRGGQ---- 218

  Fly   515 SAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQ 579
                          .||..||||.||.||:......:.:..||.|            |:      
  Rat   219 --------------KKKGNKHKWVPLQIDMKPEVPREKLASRPTR------------PQ------ 251

  Fly   580 PGAGGAGVESRHPHAGRHPY-GSRPAT----ATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAA 639
                    |.||..|.|... ||.|||    :.:....:|:..:....|..|:..:.:....||.
  Rat   252 --------EPRHTPAIRGEIKGSEPATYMPVSVAPPTPAWQPETKPEPAWHDQDETSSVKSDGAG 308

  Fly   640 GTGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYA-NYLPADAAGADSQ 703
            |.            |..:||..:|||    :|.||.......|.    :|. .|...|.......
  Rat   309 GA------------RASFRGRGRGRG----RGRGRGRGGTRTHF----DYQFGYRKFDGTEGSRT 353

  Fly   704 SSYVLMGTHYFGNVPAAYI-ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLI 767
            ..|:...|:||.||.:..| .:|...:|:.||:|:|||||||||..|||||||||.:|::|:|||
  Rat   354 PKYMNNITYYFDNVSSTEIYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLI 418

  Fly   768 ASFHRVLALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQE 832
            ||||||.|||||:::|..|:|:|..:|:.| .|||.:..|..||:...|.|:             
  Rat   419 ASFHRVQALTTDISLIFAALKDSKVVEMVE-EKVRRREEPEKWPLPGPPIVD------------- 469

  Fly   833 QLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIA 897
             ..|.|..:.|                                |....||     :|..:..|.:
  Rat   470 -YSQTDFSQLL--------------------------------NCPEFVP-----RQHYQKETES 496

  Fly   898 ALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEG 962
            |..|..|::.:..:.|        .:|.|....|..|.|.||..:.:                  
  Rat   497 APGSPRAVTPVPTKTE--------EVSNLKTLPKGLSASLPDLDSES------------------ 535

  Fly   963 IWKEVKRRSKTNAIKENATTPPQ-------QQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPS 1020
             |.|||:|.:.:..:...:..|:       .||.|..|.::.:.|                    
  Rat   536 -WIEVKKRPRPSPARPKKSEEPRFSHPTALPQQIPSQQLMSKDQD-------------------- 579

  Fly  1021 NASSSATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQC 1085
                                                                             
  Rat   580 ----------------------------------------------------------------- 579

  Fly  1086 HAEKEELDFQFDEEL--MDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRAP-- 1146
              |:|||||.||||:  ||      ||.|.||. :||:| ||||..|||:||:|||.|.  .|  
  Rat   580 --EQEELDFLFDEEMEQMD------GRKNTFTA-WSDED-SDYEIDDRDVNKILIVTQT--PPYM 632

  Fly  1147 -KHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWT---------TTNVVADYKTVNVISQA 1201
             :|.|.|||.:.|||.|::.:|..:|||||..||:||||         ....|.::|.||:||:.
  Rat   633 RRHPGGDRTGNHTSRAKMSAELAKVINDGLFYYEQDLWTEKFEPEYSQIKQEVENFKKVNMISRE 697

  Fly  1202 DFEKLAGGRNKSVLPPQVVPPPPPFEED-----LDETLVG---DTTLNSTLNNTL---------- 1248
            .|:.|.  ....|.|.|.|||.||..:.     |...|.|   .:|:..:|..|:          
  Rat   698 QFDTLT--PEPPVDPNQEVPPGPPRYQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNAR 760

  Fly  1249 ------------KSRRARFY-AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTT 1300
                        .|:.:||| ......::|.:.|||||.||::|||:|:||||::|:.||||||.
  Rat   761 TPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTA 825

  Fly  1301 SMGS--SAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGY 1363
            |:.|  |.|| |...|||    ..|||||.||||||.|||||.|||..||||..|||.||:|||.
  Rat   826 SISSSPSEGT-PAVGSYG----CTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGI 885

  Fly  1364 GQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIY 1428
            |||||||||:||||||||::|||.||.||:.||||||..|:|||||||||::|||||||||.:|:
  Rat   886 GQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIF 950

  Fly  1429 QDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEML 1493
            :|||:||:.|||.|||||||||||||||.| .:.|::.|||.|||..|:.:|||| |:|.:.|  
  Rat   951 KDFQEETVKDYEAGQLYGLEKFWAFLKYSK-AKNLDIDPKLQEYLGKFRRLEDFR-VDPPMGE-- 1011

  Fly  1494 QGVGSLNP----GRQLNRHRSVSESDGTAVIAAGGRRLNTTITNRSDYVGRLLQQQH 1546
            :|....:|    |....|.|..|:|....  |.|..:..||.|.::.........||
  Rat  1012 EGNHKRHPVVAGGSGEGRKRCPSQSSSRP--ATGISQPPTTPTGQATREDAKWTSQH 1066

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 47/73 (64%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 28/38 (74%)
Larp1XP_017453124.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
65.880

Return to query results.
Submit another query.