DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and SPAC1527.03

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_594554.1 Gene:SPAC1527.03 PomBaseID:SPAC1527.03 Length:475 Species:Schizosaccharomyces pombe

Alignment Length:548 Identity:106/549 (19%)
Similarity:188/549 (34%) Gaps:178/549 (32%)


  Fly   422 GSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSN----------- 475
            |:|...|.|.::...|..|::.|......:.|..::..:::.:.:.....||.|           
pombe    26 GTGAVISEEREKEVLKNLQNSLTGKTAEENLNDEANHTSSDKSKSEDYQPSNVNVWALRKEKMIP 90

  Fly   476 -------------PSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPA 527
                         .|......|...:.:.....|........:|:...|.||.            
pombe    91 KKHSHVKQEKRFSKSLQLQDPNVWPSPEIAEKQVEDRKLSDDSQKPLAPKANG------------ 143

  Fly   528 LTKKIPKHKWRPL-------PIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGA 585
                  |.||..:       ||...||||.:..|.|.|                           
pombe   144 ------KEKWVTITPNFTHTPISNRKSSRSRNDGSRRN--------------------------- 175

  Fly   586 GVESRHPHAGRHPYGSRPATATSERVDSWRSSSSTTTAA---------FDEQRSGAAGGAGAAGT 641
            |...|..:...|....|....:.|: |:.||..|:..:|         |..|...:|.|.....|
pombe   176 GNGRRRGNYSSHGSNKRQTNYSREK-DASRSIDSSNPSAEYRDDINNTFGSQTVSSANGKEVPQT 239

  Fly   642 GVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSY 706
            ...|::      :.|:.....|... |:||..:.:|:                    .:|||.|:
pombe   240 SEDSSS------QAPHHSSSSGHAP-SQQGGNKHSYK--------------------KSDSQQSF 277

  Fly   707 VLMGTH----------YFGNV--------PAAYIELDAN-------SIKEAIKKQVEYYFSVDNL 746
            ...|.:          ::.|:        |...:.::.|       .::..:..|:|||||::||
pombe   278 HHKGRNTRKGQRHNNGFYRNIANNIQGPFPNYPVVVNGNGVNPYLCDVQAFLTSQLEYYFSIENL 342

  Fly   747 TGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELF------EGYKVRTKT 805
            ..|.|||:.||.|||:|:..:|||:|:.:.:||:.::..|.|.||.:::.      ...|||.|.
pombe   343 CKDMFLRKHMDDEGYVPLAFLASFNRIKSFSTDLNLLHAACKASDIIDVAIDLQSPMSIKVRRKE 407

  Fly   806 TPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNS--- 867
            |.:.|                       :..::.:.|.|.     :..|.:.|:.:..||.|   
pombe   408 TWSPW-----------------------ILPSESRLKFEM-----AKYPQINSSSSMSPLASSIS 444

  Fly   868 ---IPPPPMPRNPQNLVPKMLQDKQQSR 892
               |.||.:|.:..:::.:.:|.:.:.:
pombe   445 NLTISPPFIPSSVDSIIKRDVQTEVEDK 472

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 31/79 (39%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
SPAC1527.03NP_594554.1 LHP1 4..473 CDD:227520 106/549 (19%)
LA 323..406 CDD:128955 31/83 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T1125085
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.