DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and sla1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_593315.1 Gene:sla1 PomBaseID:SPAC57A10.10c Length:298 Species:Schizosaccharomyces pombe

Alignment Length:136 Identity:47/137 (34%)
Similarity:68/137 (50%) Gaps:24/137 (18%)


  Fly   728 SIKEA-IKKQVEYYFSVDNLTGDFFL---RRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIK 788
            |..|| :.||||:|||..||..|.||   .:|.|  |::|:..||:|.|:... ..:..||||::
pombe    61 SFDEAEVLKQVEFYFSDTNLPHDKFLWTTSQKND--GWVPIQTIANFKRMRRF-QPLEAIVNALR 122

  Fly   789 ES-DKLELFE-GYKVRTKTTPTTWPITEVPEVNEGEP----KAIGTLEQEQLEQNDGQEKLEEQT 847
            :| :.||:.| |.|||...     |:..|...:..|.    |..|.      |::|.|..||:..
pombe   123 KSPELLEVDEAGEKVRRMI-----PLVRVDNKSVMERSVYCKGFGD------EKDDTQIALEKFF 176

  Fly   848 EADSPP 853
            |.::.|
pombe   177 EENAGP 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 34/79 (43%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
sla1NP_593315.1 LHP1 1..298 CDD:227520 47/137 (34%)
LA_like_fungal 64..139 CDD:153398 34/78 (44%)
RRM1_La 155..232 CDD:240737 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.