DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_291029.2 Gene:LARP1 HGNCID:29531 Length:1096 Species:Homo sapiens

Alignment Length:1455 Identity:446/1456 (31%)
Similarity:587/1456 (40%) Gaps:506/1456 (35%)


  Fly   146 GGRGDGQKPQQAGGRRVPGSSDTERKSVRPRAPRGGSPRKSAAGAAGAAGSNAGAVSSAVPGGPK 210
            ||....:.|....|:..||.:|.          |||.|              .|:.....|...|
Human    22 GGLVRKKPPPAPEGKGEPGPNDV----------RGGEP--------------DGSARRPRPPCAK 62

  Fly   211 VHKDRKDTSPSASIEGAGSSGNEAKS------------ADGDQQAGEK----GAAGAAPPPKR-F 258
            .||           ||.|....|:..            :||::..||.    ||||||...:| |
Human    63 PHK-----------EGTGQQERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDF 116

  Fly   259 IAAPPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQ 323
            :.|||||||.|                 .|..|.|..                        .|..
Human   117 VEAPPPKVNPW-----------------TKNALPPVL------------------------TTVN 140

  Fly   324 QQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADA 388
            .|.|.:                           .:|.|....||||                   
Human   141 GQSPPE---------------------------HSAPAKVVRAAVP------------------- 159

  Fly   389 LAKVVVKDKKKVNQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSN 453
                    |::...|..||.:..:|||.......|.:..|::|:  ||:|....|.         
Human   160 --------KQRKGSKVGDFGDAINWPTPGEIAHKSVQPQSHKPQ--PTRKLPPKKD--------- 205

  Fly   454 TTSSEVATESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAG 518
                   .:....|..|.|..:|.:.:..:....|.            |...||..:        
Human   206 -------MKEQEKGEGSDSKESPKTKSDESGEEKNG------------DEDCQRGGQ-------- 243

  Fly   519 TTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAG 583
                      .||..||||.||.||:......:.:..||.           |||           
Human   244 ----------KKKGNKHKWVPLQIDMKPEVPREKLASRPT-----------RPP----------- 276

  Fly   584 GAGVESRHPHAGRHPY-GSRPAT--ATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGS 645
                |.||..|.|... ||..||  ..:....:|:.......|..|:..:.:....||.|.    
Human   277 ----EPRHIPANRGEIKGSESATYVPVAPPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGA---- 333

  Fly   646 ATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYA-NYLPADAAGADSQSSYVLM 709
                    |..:||..:|||    :|.||.......|.    :|. .|...|.........|:..
Human   334 --------RASFRGRGRGRG----RGRGRGRGGTRTHF----DYQFGYRKFDGVEGPRTPKYMNN 382

  Fly   710 GTHYFGNVPAAYI-ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRV 773
            .|:||.||.:..: .:|...:|:.||:|:|||||||||..|||||||||.:|::|:|||||||||
Human   383 ITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRV 447

  Fly   774 LALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQND 838
            .|||||:::|..|:|:|..:|:.: .|||.:..|..||:                          
Human   448 QALTTDISLIFAALKDSKVVEIVD-EKVRRREEPEKWPL-------------------------- 485

  Fly   839 GQEKLEEQTEADSPPPILTSAMA--TKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNS 901
                          |||:..:..  ::.||.  |..:||             |..:..|.:|..|
Human   486 --------------PPIVDYSQTDFSQLLNC--PEFVPR-------------QHYQKETESAPGS 521

  Fly   902 VNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKE 966
            ..|::.:..:.|        .:|.|....|..|.|.||                  .:.|. |.|
Human   522 PRAVTPVPTKTE--------EVSNLKTLPKGLSASLPD------------------LDSEN-WIE 559

  Fly   967 VKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVT 1031
            ||:|.:           |...:|..|:                                      
Human   560 VKKRPR-----------PSPARPKKSE-------------------------------------- 575

  Fly  1032 TNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAP---PSAQCHA----EK 1089
                                                  .|:.|..|:.|   ||.|..:    |:
Human   576 --------------------------------------ESRFSHLTSLPQQLPSQQLMSKDQDEQ 602

  Fly  1090 EELDFQFDEEL--MDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGR-APKHEGY 1151
            |||||.||||:  ||      ||.|.||.  ..|:|||||..|||:||:|||.|... ..:|.|.
Human   603 EELDFLFDEEMEQMD------GRKNTFTA--WSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGG 659

  Fly  1152 DRTADFTSRTKITQDLENIINDGLVNYEEDLWT---------TTNVVADYKTVNVISQADFEKLA 1207
            |||.:.|||.|::.:|..:|||||..||:|||.         ....|.::|.||:||:..|:.|.
Human   660 DRTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQFDTLT 724

  Fly  1208 GGRNKSVLPPQVVPP-PPPFEEDLDETLVG-------DTTLNSTLNNTL---------------- 1248
              ....|.|.|.||| ||.|::...:.|..       .:|:..:|..|:                
Human   725 --PEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNTRTPRTPR 787

  Fly  1249 ------KSRRARFY-AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGS-- 1304
                  .|:.:||| ......::|.:.|||||.||::|||:|:||||::|:.||||||.|:.|  
Human   788 TPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSP 852

  Fly  1305 SAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEM 1369
            |.|| ||..|||    ..|||||.||||||.|||||.|||..||||..|||.||:|||.||||||
Human   853 SEGT-PTVGSYG----CTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEM 912

  Fly  1370 NTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDE 1434
            |||:||||||||::|||.||.||:.||||||..|:|||||||||::|||||||||.:|::|||:|
Human   913 NTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEE 977

  Fly  1435 TIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVGSL 1499
            |:.|||.|||||||||||||||.| .:.|::.|||.|||..|:.:|||||..|            
Human   978 TVKDYEAGQLYGLEKFWAFLKYSK-AKNLDIDPKLQEYLGKFRRLEDFRVDPP------------ 1029

  Fly  1500 NPGRQLNRHRSVSESDGTAVIAAGG 1524
             .|.:.|..|.       :|:|.||
Human  1030 -MGEEGNHKRH-------SVVAGGG 1046

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 46/73 (63%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 28/38 (74%)
LARP1NP_291029.2 Required for interaction with PABPC1. {ECO:0000269|PubMed:29244122} 77..573 182/779 (23%)
LARP_1 404..476 CDD:153406 46/73 (63%)
Required for interaction with RPTOR and for repression of mRNAs with a 5'TOP motif. {ECO:0000269|PubMed:29244122} 574..1096 244/586 (42%)
Interaction with mRNA. {ECO:0000269|PubMed:20430826, ECO:0000269|PubMed:26206669} 873..1023 108/151 (72%)
DM15 885..925 CDD:128927 32/40 (80%)
DM15 926..964 CDD:128927 28/38 (74%)
Interaction with 7-methylguanosine mRNA cap structure. {ECO:0000244|PDB:5V87, ECO:0000269|PubMed:28379136} 956..999 33/43 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 551 1.000 Inparanoid score I1118
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T609611
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.960

Return to query results.
Submit another query.