DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and LARP4B

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_016871476.1 Gene:LARP4B HGNCID:28987 Length:1273 Species:Homo sapiens

Alignment Length:1284 Identity:242/1285 (19%)
Similarity:383/1285 (30%) Gaps:435/1285 (34%)


  Fly   160 RRVPGSSDTER-----KSVRPRAP---------------RGGSPRKSAAGAAGAAGSNAGAVSSA 204
            |.:...:|:|:     |||..:.|               :|....::.:||:..||.:|.....|
Human     7 RELSSDNDSEKTGLLQKSVEEKEPENKISKTLSSLFDTVKGEEVHRTGSGASSVAGVSARTRIFA 71

  Fly   205 VPGGPKVHKDRKDTSPSASI--------EGAGSSGNEAKSADGDQQA---------GEKGAAGAA 252
            ..|..:.|:.::..:|.:|.        |..|.:...:.....:|.:         |.....|..
Human    72 GSGHKQGHRPKQSLNPLSSFIYTFSTRYENLGENDKNSDIVVNEQNSEGVCDLLCVGNGSRQGCW 136

  Fly   253 PPPKRFIAAPPPKVNAWKISAKQSGS----PKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQ 313
            ...:.|.....|.....:..|..||.    |....:.|.::.:............::...::..:
Human   137 EDEELFSCVLVPSDRGLQEEAFVSGHLHCYPATCKNSLVEKEMVVSVHLSSGDESKSLDLSDRER 201

  Fly   314 NTASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATT 378
            ...:......||....|.........|.:|..:.|........:.||.....::||:|:...:..
Human   202 KDGNPVGIDDQQCQDSGECKFHSICVADSACPSVAEELGTWVDTVAARGECCSSVPSASRAMSGA 266

  Fly   379 TTVDASQADALAKVVVKDKKKVNQKASDFSNVGDWPTL-----IGGTSGSGK------ATSNEP- 431
            ...:..|.:                      :..|.||     .|..||..|      |.|:.| 
Human   267 GEPEPRQEE----------------------LSPWDTLGPGERTGECSGKAKPCPEPVAFSHAPC 309

  Fly   432 KRNPTKKQQSAKTAAA-------VAASS------------NTTSSEVATESNVAGTTSSSNS--- 474
            :.|....|..|..|.|       .|.||            |...|:..:.:.|.|.:.|.||   
Human   310 EANTDNVQMEALQAEACTEFPKNYAESSALHGIDLLPELNNNMDSDSLSHACVLGESESCNSGVG 374

  Fly   475 ----------------NPSSSTTTTNTTTNS---QATTAPVASTSHDAKAQR------------- 507
                            :|.|..|.|.....|   :..|..|..:.|..|.:.             
Human   375 SEMDHPPGGFRTDTAHSPGSFCTDTACVAGSDDPEVVTVVVDQSLHSKKERENNSITPLRDNDDF 439

  Fly   508 ------------------DAEPAANSAAGT--TGTAAGPALTKKIPKHK----WRPLPIDLAKSS 548
                              |..|.....|..  :|..:|.|.:::....:    |.|.|:      
Human   440 YLDVNKADSILPVGLDRIDLSPKRPITAVRFGSGCLSGHANSREAAPSQLDDCWEPEPV------ 498

  Fly   549 RPKPIGGRPNRRFSDDIADQRRPPRVYHDRQ-----PGAGGAGVESRHPHAGRHPYGSRPATATS 608
             |:.:  |..:|..|...:.|.|  :..||:     |.:....|...|...|:..    |||..|
Human   499 -PRQV--RKAQRRGDCSLEARSP--LLPDRENTPQLPVSEDGVVWGWHDRDGQFV----PATKVS 554

  Fly   609 E---RVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGS--ATRGPRRYRTPYRGGRQGRGGFS 668
            |   ..:.|.:      .....:.|.||.|..||...|..  |.|||           ||.....
Human   555 ELNPNAEVWGA------PVLHLEASSAADGVSAAWEEVAGHHADRGP-----------QGSDANG 602

  Fly   669 RQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANS----- 728
            ....|.....:|.            |.::..||..:  :.:|       |:.|..|..||     
Human   603 DGDQGHENAALPD------------PQESDPADMNA--LALG-------PSEYDSLPENSETGGN 646

  Fly   729 ---------IKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIV 784
                     .:|.:||.:|:..|.:||..|.:|..:||.:.|:|:|.:|:...:..|:|||.:||
Human   647 ESQPDSQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIV 711

  Fly   785 NAIKESDKLELFE-GYKVR---------TKTTPTTWPITEVPEVNEGE--PKAIG---------- 827
            ..::....:::.| |.|||         .:....:.|:.||..:.:|:  ||.|.          
Human   712 EVLRSLPLVQVDEKGEKVRPNQNRCIVILREISESTPVEEVEALFKGDNLPKFINCEFAYNDNWF 776

  Fly   828 -TLEQEQLEQNDGQEK---LEEQTEADSPPPILTSAMATK-------PLNSIPP----------- 870
             |.|.|.    |.|:.   |.|:.:.....||.....|..       |.|...|           
Human   777 ITFETEA----DAQQAYKYLREEVKTFQGKPIKARIKAKAIAINTFLPKNGFRPLDVSLYAQQRY 837

  Fly   871 ------PPMPRNPQNLVPKMLQDKQQSRSSTIAALN-----------------------SVNAIS 906
                  ||| .:||...|.......|:.|:|.:.|:                       :.:.::
Human   838 ATSFYFPPM-YSPQQQFPLYSLITPQTWSATHSYLDPPLVTPFPNTGFINGFTSPAFKPAASPLT 901

  Fly   907 ALTQQVEGGAAELAGHL----------SGLAESVKP-----------KSTSTPDKRNAA------ 944
            :|.|...........||          .||.||  |           ....:|..|.|.      
Human   902 SLRQYPPRSRNPSKSHLRHAIPSAERGPGLLES--PSIFNFTADRLINGVRSPQTRQAGQTRTRI 964

  Fly   945 ---------SAGNGAGSAAALVAEPEGIWK--------EVKRRSKTNAIKENATTPPQQQQPPLS 992
                     .||.|.....:|.:.| |:.:        ..||..|..:.:..:.|||:...|...
Human   965 QNPSAYAKREAGPGRVEPGSLESSP-GLGRGRKNSFGYRKKREEKFTSSQTQSPTPPKPPSPSFE 1028

  Fly   993 QTLNN------NNDNVKTNNTSSKSKSSSNNAPS---NASSSATV-----------CVTTNNASS 1037
            ..|::      ...|:||.:......||....||   ..|:.|:|           .|..:.|.|
Human  1029 LGLSSFPPLPGAAGNLKTEDLFENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVS 1093

  Fly  1038 AT--------------KATTKTTTT-------STATTTTNNNIKSGNAAYSKTHSKSSSKTAA-- 1079
            ||              |...|...|       |..|.|...:::...||..:|....|..|||  
Human  1094 ATYERSPSPAHLPDDPKVAEKQRETHSVDRLPSALTATACKSVQVNGAATVRTSCLPSCTTAARL 1158

  Fly  1080 -------------------------------------PPSAQCHAEKEE 1091
                                                 |||:....:||:
Human  1159 WCEQTLRTPAPARFLITSNLELRKPSYAEICQRTSKEPPSSPLQPQKEQ 1207

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/83 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
LARP4BXP_016871476.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121327463
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.