DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp4b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_011242555.1 Gene:Larp4b MGIID:106330 Length:1723 Species:Mus musculus

Alignment Length:1434 Identity:266/1435 (19%)
Similarity:423/1435 (29%) Gaps:509/1435 (35%)


  Fly    18 TVAASGSATTSYANVVQNLETKKSGTSNTTTTTARATVDNKENQPNLKSFKSWSEEAAAAEAAGE 82
            :|:.|| .|.|:.....||..:|..:.:.          :::..|...:||    |||.::..|.
Mouse   444 SVSRSG-RTLSFGLDKINLSPEKLASESL----------DRDYLPVHANFK----EAALSKLDGP 493

  Fly    83 SPI-------------------VGSVSLAQTGEKRAAASGGDNTAENSSELDDNNDFVPVLSHHR 128
            :||                   .||:.||..||....       :||||...| .|.:.:|....
Mouse   494 NPISHRGPVCVEEQPLGDSNLETGSIQLANRGELFLC-------SENSSICQD-EDKMSILETES 550

  Fly   129 RDRKKARKEKPRDQQPAGGRGDGQKPQQAGGRRVPGSSDTE---------RKSVRPRAPRGGSPR 184
            |.:::.:.....| ...|.|.|..:.:.....:|....|||         :..:..|.|...|..
Mouse   551 RAKRELKSWCQAD-VCRGNRADKAQRETYDLTQVKSEPDTEEVVQKADLLKLGLSQRMPNDESHS 614

  Fly   185 KSAAGAA-------GAAGSNAGAVSSAVPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADG--- 239
            :...|..       ...|..|.........|.|||                     .||..|   
Mouse   615 RPHQGTVTPPAFIFTCTGPEARETGLHDKTGDKVH---------------------VKSLVGVLH 658

  Fly   240 DQQAGEKGAAGAAPPPKRFIAAPPPKVNAWKISAKQSGSPKAG----TSPLDKRV---------- 290
            :|.:|....|.|...|:        |.|..:|..|.:|:.::.    ||.|.|.|          
Mouse   659 NQFSGPYVLANAEKEPQ--------KANYREICEKNTGNAESSFHWETSVLSKVVPNGNMVTCIG 715

  Fly   291 ----LQPKAQQQQ-QQTKQTASQNNNAQNTASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAA 350
                ..|..:..| :.:.:|...|.:...|...........|::....:.::....         
Mouse   716 IGIAADPDCETNQIENSYRTDGVNEDPDLTVVPPLNHSLLSPEEEWANSDRSPDLC--------- 771

  Fly   351 ATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKKKVNQKASDFSNVGDWPT 415
              ...|.:....|.|....|:.......|..:.::...|      ||...|..::          
Mouse   772 --LINTESIQDVSKAFGNDASELSKEKLTCKEENETLGL------DKDSNNPNST---------- 818

  Fly   416 LIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESNVAGTTSSSNSNPSSST 480
               |..|..|          ||::::..|     ...:|...|:....|...|...:..:.||..
Mouse   819 ---GCLGPCK----------TKRKKARST-----VKESTLHGEIQFLGNSDVTFKKTALHDSSEV 865

  Fly   481 TTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANS------------AAGTTGTAAGPALTKKIP 533
            .::.....|.....|.||.. :|.....|.||.|:            |:.|.|.:..|:      
Mouse   866 CSSLIDVKSIRVDMPAASPG-NAPLAIPAIPADNTGCVVPSADQDHIASPTEGVSENPS------ 923

  Fly   534 KHKWRPLPID----LAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPG-AGGAGVESRHPH 593
            :..|..:|.:    ........|:||..::..|                  | |||         
Mouse   924 EMDWHRIPEEFYAHFLNEFSYYPVGGLASQALS------------------GLAGG--------- 961

  Fly   594 AGRHPYGSRPATATSERVD----------------------------------------SWRSSS 618
            .||:..|...|...:|.:.                                        .|.|..
Mouse   962 CGRYQVGYLWANTATENMTEDAQFFNEDLHSKPQYLENTSFSLEQTPFQLPVTEDGVIWGWPSRG 1026

  Fly   619 S---TTTAAFDEQRSGAAGG-------AGAAGTGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPG 673
            .   .||...:...:....|       |.:|..||.:|.                     .:.||
Mouse  1027 GQLVPTTKVSELNPNAKVWGTHMLHLEASSAAVGVNAAW---------------------EEAPG 1070

  Fly   674 RPTYRIPRHLL---ASGE----YANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANS--- 728
            .|| ...:.:|   |:|:    ..|....||..|:......|...|      :.|..|..|:   
Mouse  1071 HPT-DCDQQVLGLDANGDGDKSRENAALPDAQEAEQTDMSTLALDH------SEYEPLPENNDTG 1128

  Fly   729 -----------IKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAV 782
                       .:|.:||.:|:..|.:||..|.:|..:||.:.|:|:|.:|:...:..|:|||.:
Mouse  1129 GNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDL 1193

  Fly   783 IVNAIKESDKLELFE-GYKVR---------TKTTPTTWPITEVPEVNEGE--PKAIG-------- 827
            ||..::....:::.| |.|||         .:....:.|:.||..:.:|:  ||.|.        
Mouse  1194 IVEVLRSLPLVQVDEKGEKVRPNQNRCIVILREISESTPVEEVEALFKGDNLPKFINCEFAYNDN 1258

  Fly   828 ---TLEQEQLEQNDGQEK---LEEQTEADSPPPILTSAMATK-------PLNSIPP--------- 870
               |.|.|.    |.|:.   |.|:.......||.....|..       |.|...|         
Mouse  1259 WFITFETEA----DAQQAYKYLREEVRTFQGKPIKARIKAKAIAINTFLPKNGFRPLDMNLYTQQ 1319

  Fly   871 --------PPMPRNPQNLVPKMLQDKQQSRSSTIAALN-----------------------SVNA 904
                    ||: .:||...|.......|:.|:|.:.|:                       :.:.
Mouse  1320 RYATSFYLPPV-YSPQQQFPLYSLITPQTWSTTHSYLDPPLVTPFPSTGFINGFTSPTFKPATSP 1383

  Fly   905 ISALTQQVEGGAAELAGHL----------SGLAESVKP-----------KSTSTPDKRNAASA-- 946
            :::|.|...........||          .||.||  |           ....:|..|.|...  
Mouse  1384 LTSLRQYPPRSRNPSKSHLRHAIPSTERGPGLLES--PSIFNFTADRLINGVRSPQTRQAGQTRT 1446

  Fly   947 -------------GNGAGSAAALVAEPEGIWK--------EVKRRSKTNAIKENATTPPQQQQPP 990
                         |.|....::|.:.| |:.:        ..||..|..:.:..:.|||:...|.
Mouse  1447 RIQNPSAYAKREIGTGRVEPSSLESSP-GLGRGRKNSFGYRKKREEKFTSSQTQSPTPPKPPSPS 1510

  Fly   991 LSQTLNN------NNDNVKTNNT-----------SSKSKSSSNNAPSNA---------SSSATVC 1029
            ....|:|      ...|:||.:.           |||.::.|.:|.:|.         |..|...
Mouse  1511 FELGLSNFPPLPGAAGNLKTEDLFENRLSSLIIGSSKERNLSTDASTNTVPVVGPREPSVPAPCA 1575

  Fly  1030 VTTNNASSAT--------KATTKTTTT-------STATTTTNNNIKSGNAA-------YSK---- 1068
            |:.....|.:        |...|...|       ||.|||...:::...||       |::    
Mouse  1576 VSAAFERSPSPVHLPEDPKVAEKQRETQSVDRLPSTPTTTACKSVQVNGAATELRKPSYAEICQR 1640

  Fly  1069 -THSKSSSKTAAPPSAQ------CHAEKEELDFQFDEELMDPL--------------------PP 1106
             :...|||....||..|      |..|:::|....:.....|.                    ||
Mouse  1641 TSKDPSSSSPLQPPKEQKPSTVACGKEEKQLSEPVERHREPPALKSTPGVPKDQRRQPGRRASPP 1705

  Fly  1107 GTGR 1110
            ..|:
Mouse  1706 AAGK 1709

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/83 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp4bXP_011242555.1 LARP_5 1141..1215 CDD:153405 26/74 (35%)
RRM_LARP5 1220..1296 CDD:241150 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121326981
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.