DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp1b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_017175009.1 Gene:Larp1b MGIID:1914604 Length:746 Species:Mus musculus

Alignment Length:932 Identity:219/933 (23%)
Similarity:311/933 (33%) Gaps:363/933 (39%)


  Fly    87 GSVSLAQTGEKRAAAS---GGDNTAENSSELDDNN--DFVPVLSHHRRDRKKARKEKPRDQQPAG 146
            ||.:...:||.|..|:   ||...|..|:..:|.:  ...|      |....|.:::.....|.|
Mouse    40 GSGAPGASGELRPCAATRPGGGRLALRSAGGEDGHAGRCTP------RRAGSASQDRSGSVPPCG 98

  Fly   147 GRGD---------------GQKPQQAGGRRVP------------GSSD-----TERKSVRPRAP- 178
            .||.               ||.|..:....||            |..|     |.|::.:| || 
Mouse    99 ERGGRAPWTRTAPGWAGGWGQGPAMSARAPVPAAATREDPPAVAGDRDALLAATSRRAEQP-APG 162

  Fly   179 -RGG----SPRKSAAGAAGAAGSNAGAV-------SSAVPGGP-KVHKDRKDTSPSASIEGAGSS 230
             |.|    ..|.:||.:|||.|..:.|:       .:|||..| .:|...|..:|      .|..
Mouse   163 EREGKEAREERAAAATSAGARGEPSPALVLGHSVPQAAVPVRPLALHLAHKARAP------GGPF 221

  Fly   231 GNEA--------------------KSADGDQQAGEKGAAGA---APPPKRFIAAPPPKVNAWKIS 272
            |.||                    ...|..:.|.|..||..   .|||      ||||.|.|   
Mouse   222 GGEAPPLPPPPPPPPPPPPPLPPPAPRDPPEDAREDPAAAGPEDKPPP------PPPKGNPW--- 277

  Fly   273 AKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGATTTTQT 337
                                         ||:.                     ||..:|..|  
Mouse   278 -----------------------------TKKL---------------------PQHLSTVGT-- 290

  Fly   338 TTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKDKKKVNQ 402
                       ...:.|..|..|..||...:.|.                       |.|.|.:.
Mouse   291 -----------GVPSPAQDSPEAELSSPKIIKAG-----------------------KLKTKKSN 321

  Fly   403 KASDFSNVGDWPT---LIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVATESN 464
            ||||||::.:|||   |:  .:||....:...|:...:|::..|    :...||:.|.| ..|:.
Mouse   322 KASDFSDMANWPTPGELV--NTGSQSVINQGNKKPQIRKEKEEK----IEKRSNSESKE-NREAK 379

  Fly   465 VAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALT 529
            :.|.|.:.:.:.:.|:                        :||                      
Mouse   380 LDGPTENISEDEAQSS------------------------SQR---------------------- 398

  Fly   530 KKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESR-HPH 593
            |:..||||.||.:|          ..||:        .|.||            |:...|| .|.
Mouse   399 KRANKHKWVPLHLD----------DVRPD--------SQERP------------GSRNSSRCQPE 433

  Fly   594 AGRHPYGSRPATATSERVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYR 658
            |.:..:.:|.:...     |||.......   |:....:....|  ||..|| |||        |
Mouse   434 ANKPTHSNRKSDTR-----SWRREREKRD---DQDEVSSVRSEG--GTIRGS-TRG--------R 479

  Fly   659 GGRQGRGGFSRQGPGRPT--------YRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFG 715
            |..:|||  ..:|.|.|.        ||.|      ||...    .....:..:|   |..:|..
Mouse   480 GRGRGRG--RGRGRGNPRLNFDYSYGYREP------GERTE----QPFSTELNTS---MMYYYDD 529

  Fly   716 NVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDV 780
            ........::...:||.||:|:|||||.:||..|||||||||.:|::|::|||.||||.||||::
Mouse   530 GTGVRVYPVEETLLKEYIKRQIEYYFSTENLERDFFLRRKMDEQGFLPISLIAGFHRVQALTTNL 594

  Fly   781 AVIVNAIKESDKLELFEGYKVRTKTTPTTWPI----------------TEVPEVNEGEPKAIG-- 827
            .:|:.|:|:|.::|:.: .|:|.|..|..|||                .:.||...|:  |.|  
Mouse   595 NLILEALKDSTEVEIVD-EKMRKKIEPEKWPIPGPPPRNVPQTDFSQLIDCPEFIPGQ--AFGSH 656

  Fly   828 ---TLEQE----------------------------QLEQNDGQEKLEEQTEADSPPPILTSAMA 861
               |.|::                            |:.||....||........|..:|.:...
Mouse   657 TESTKEEDESRHKPPSRVSRWVGDGVQGPWAKTTLCQVYQNYSAGKLNIHEHTTEPRSLLYTIFK 721

  Fly   862 TKPLNSIPPPPMPRNPQNLVPK 883
            .|.|......|..:|...:|||
Mouse   722 KKTLKVKTSKPDLKNSNYIVPK 743

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 41/73 (56%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp1bXP_017175009.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121184538
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.