DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and Larp4

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001271452.1 Gene:Larp4 MGIID:2443114 Length:720 Species:Mus musculus

Alignment Length:532 Identity:110/533 (21%)
Similarity:188/533 (35%) Gaps:161/533 (30%)


  Fly   683 LLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLT 747
            ::...|..:|...|.:|..|.:                   :....:||.:|||:|:.||.:||:
Mouse    89 MILGPEDLSYQLYDVSGESSSA-------------------ISTEDLKECLKKQLEFCFSRENLS 134

  Fly   748 GDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE-GYKVR--------- 802
            .|.:|..:||.:.::|:..:|:...:..|||:..:|:..::.|..:::.| |.|||         
Mouse   135 KDLYLISQMDSDQFVPIWTVANMEEIKKLTTNTDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVI 199

  Fly   803 TKTTPTTWPITEVPEV--NEGEPKAIG-----------TLEQEQLEQNDGQEK---LEEQTEADS 851
            .:..|.|.|:.||..:  ||..||.|.           |.:.:    .|.|:.   |.|:.:...
Mouse   200 LREIPETTPVEEVKALFKNENCPKVISCEFAHNSNWYITFQSD----TDAQQAFKYLREEVKTFQ 260

  Fly   852 PPPILT------------------SAMATKPLNSIPPPPMP------RNPQ-----NLVPKMLQD 887
            ..||:.                  |:|.|:|:.:....|.|      .|||     :|||     
Mouse   261 GKPIMARIKAINTFFAKNGYRLMDSSMYTQPIQTPTQYPSPVFMQPVYNPQQYSVYSLVP----- 320

  Fly   888 KQQSRSSTIAAL-----------NSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKR 941
              ||.|.:.|..           :.||..|:........||...|.       ..||:...|..|
Mouse   321 --QSWSPSPAPYFETPLAPFPNGSFVNGFSSPGSYKTNAAAMNMGR-------PFPKNRVKPHFR 376

  Fly   942 NAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKE--NATTPPQQQQ------PPLSQTLNN- 997
            :::.:.:....:.:|...|      :.|.|....:.|  |.|...||:|      .|:.|...| 
Mouse   377 SSSGSEHSTEGSVSLGDGP------LSRSSSRIFLSERHNPTVTGQQEQTYLPKEAPILQMEQNG 435

  Fly   998 ----------------NNDNV-KTNNTSSKSKSS-------SNNAPSNASSSATV---CVTTNNA 1035
                            ::|.: :....::::|:.       :.|.|....||:.|   ....|..
Mouse   436 DFGRGRRTLFRGRRRRDDDRIPRPQPAATEAKAPTPKFDLLATNFPPLPGSSSRVPDELGLENRM 500

  Fly  1036 SSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAP----PSAQCHAEKEELDF-- 1094
            |...|...:...:.....:.....:.|          .:..|:||    ||..|.||...|..  
Mouse   501 SDVVKGVCREKDSEDVRVSCPVPAEDG----------QTDCTSAPLSISPSPPCTAEPPVLSTTQ 555

  Fly  1095 QFDEELMDPLPP 1106
            |..:::.|...|
Mouse   556 QEQDQMEDSAVP 567

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/83 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Larp4NP_001271452.1 Interaction with PABPC1. {ECO:0000250|UniProtKB:Q71RC2} 13..22
Interaction with the poly-A tract of mRNA. {ECO:0000250|UniProtKB:Q71RC2} 108..300 49/215 (23%)
LARP_4 117..191 CDD:153404 26/74 (35%)
RRM_LARP4 196..272 CDD:241151 17/80 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.