DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp-1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001040868.3 Gene:larp-1 WormBaseID:WBGene00020097 Length:1150 Species:Caenorhabditis elegans

Alignment Length:1544 Identity:374/1545 (24%)
Similarity:555/1545 (36%) Gaps:523/1545 (34%)


  Fly    59 ENQPNLKSFKSWSEEAAAAEAAGESPIVGSVSLAQTGEKRAAASGGDNTAENSSELDDNNDFVPV 123
            |.||.|...|..|.:|..|.:..:             :.:.......::.:|.:...:.....| 
 Worm     3 EKQPMLSFAKVVSGQAEDASSPSQ-------------QVQHTQDSSHSSTQNENSQPEKQAHPP- 53

  Fly   124 LSHHRRDRKK--ARKEKPRDQQPAGGRGDGQKPQQAGGRRVP-GSSDTERKSVRPRAPRGGSPRK 185
              |:||:::.  .|.|:||      |.|.|::.....|.|.| |.:.||:.              
 Worm    54 --HNRREKENVGGRSERPR------GEGKGKRRNNRKGDRKPRGETKTEKP-------------- 96

  Fly   186 SAAGAAGAAGSNAGAVSSAVPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGDQQAGEKGAAG 250
                |...|......|...|...|         :|..:|.....:..||::|....|..:|....
 Worm    97 ----AEKVATEEVKPVEIPVVLEP---------APLPAINAWFKNKEEAEAAAAAAQKEQKSETA 148

  Fly   251 AAPPPKRFIAAPPPKVNAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNT 315
            |    .:||....|.|       ::|.:|    .|..||.::|..:|.             |...
 Worm   149 A----DQFIITATPVV-------QKSSAP----IPEKKRAVEPTPKQA-------------APIK 185

  Fly   316 ASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTT 380
            ..:|..:.:::|       .:|:||                            ||||.....|.|
 Worm   186 EKSKSRESKKEP-------WKTSTA----------------------------PAATAPVTETVT 215

  Fly   381 VDASQADALAKVVVKDKKKVNQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTA 445
            |.|:|                          |||||.........:.||....|.:......||.
 Worm   216 VAATQ--------------------------DWPTLAKAELNGHVSPSNSDDNNESSSNSQHKTG 254

  Fly   446 AAVAASS--------------------NTTSSEVATESNVAGTTSSSNSNPSSSTTTTNTTTNSQ 490
            ..:..:|                    |.........:|.......|....|:|.......:.|:
 Worm   255 GKMTKNSWKKVDISVDYGSKGKGAPRGNGGEKGTRRSANDEAVRRRSGEEDSASGDEQQYWSRSK 319

  Fly   491 ATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGG 555
            ...:|:...|.|......:........||               |.|:....:.|.|..|.|   
 Worm   320 DNKSPINEMSSDRVVDSGSNGIYYQQGGT---------------HGWKKKVNNKAGSDMPTP--- 366

  Fly   556 RPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSERVDSW------ 614
             ||.. |...::...|..:..|:.|...|....:  |.|.|:  |:.  |:|::..|.|      
 Worm   367 -PNST-SPHQSESNSPEHLPKDKAPIMNGNAKNA--PAANRN--GNN--TSTAKTGDYWHKNGGE 423

  Fly   615 RSSSSTTTAAF----DEQRSGAAGGAGAAGTGVGSATRGP---------------------RRYR 654
            |....:...|:    |..::.|...|....|......|||                     .:|.
 Worm   424 RKEDKSQPKAYYQRNDRFQARANPHAPPKLTAAQRKERGPLPRWEDIEAGDDNFDYMTLMEAQYS 488

  Fly   655 TPYRGGRQGRGGFSRQ--------------------GPGRPTY-RIPRHLLASGEYANYLPADAA 698
            ..|...:|    |..|                    .|.||.. .:..||::.       |.|..
 Worm   489 QYYGAPQQ----FEHQLDPHQASILIQQAQQHMASFAPFRPPMPMLSPHLMSP-------PLDRD 542

  Fly   699 G--------ADSQSSYVLMGTHYFGNVPAAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRK 755
            |        .:..::.:.....|  |.|.|...:..:::||.::||:|||||.:||..|||||||
 Worm   543 GGVTSPVSNGEPINTAIPFAPIY--NPPTAPRPVTDDTLKEYVRKQIEYYFSEENLQKDFFLRRK 605

  Fly   756 MDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELF-EGYKVRTKTTPTTWPITEVPEVN 819
            |.||||:||.|||||.||.:||.|.::|:.|:|:|.|:::. :|.::|....||.||:  :|.|:
 Worm   606 MGPEGYLPVALIASFPRVRSLTEDYSLILEALKDSTKVDMSPDGLQIRAPVNPTIWPL--MPTVS 668

  Fly   820 EGEPKAIGTLEQEQLEQNDGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKM 884
                               |.:.|                          |.|..:.||      
 Worm   669 -------------------GADSL--------------------------PGPSSQAPQ------ 682

  Fly   885 LQDKQQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNG 949
             |.:|...::|.|.:.|                             :|:::|:..:         
 Worm   683 -QFRQNGPAATAAPVES-----------------------------QPQASSSKPQ--------- 708

  Fly   950 AGSAAALVAEPEGIWKEVKRR---------SKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTN 1005
                     :||. |:|||.|         |.:.:..:| ...|||||..|.|            
 Worm   709 ---------QPEE-WEEVKTRKGKGKGRLTSGSQSTNDN-KRQPQQQQKSLQQ------------ 750

  Fly  1006 NTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTH 1070
                                                                   ||        
 Worm   751 -------------------------------------------------------SG-------- 752

  Fly  1071 SKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTG------RINNFTENFSDDDESDYEFA 1129
                            :::.:||||||.|:..    |.|      |.....:.|....:|: |..
 Worm   753 ----------------SDQPDLDFQFDNEISG----GGGSAQTPKRPEKSKKAFLSAIDSE-EIG 796

  Fly  1130 DRDINKLLIVAQVGRAPKHEGYDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKT 1194
            |..|:||:|:     .|.....|||.||::|::...:....:..||..|||:|||... ..|..|
 Worm   797 DDVISKLIIM-----TPSRRTLDRTGDFSTRSQNQGEFNEEVEIGLRRYEEELWTVPQ-EKDIPT 855

  Fly  1195 --VNVISQADFEKLAG---GRNKSVLPPQVVPP----PPP---FEEDLDETLVGDTTLNST---L 1244
              |:.||...|.::.|   .:..|..||::..|    |.|   :.:...|......|:..:   .
 Worm   856 SKVSTISAEQFNEMRGNEDAKKTSDEPPEIPLPSGTQPTPDSVWTKKAKERAAASVTVPKSPMQR 920

  Fly  1245 NNTLKSRRARFY-----AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGS 1304
            ..:.:.:..|||     .||    :|.::|||:|.||:..||||..|.|:|...:..|       
 Worm   921 RESEEQKMNRFYPISKPTAP----LDAKSPRKKKTRHSEKPPVEMPVAWVLGREDALP------- 974

  Fly  1305 SAGTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEM 1369
            :|.....|||     |.||.:     |||.:||:|:.|.|..|..:...|||:|:.||| ...||
 Worm   975 AAPIGIAASS-----SQVPAN-----HPSISLLQEDRFVQNVYSTWRQACLKQRKSLGY-DCAEM 1028

  Fly  1370 NTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDE 1434
            ||||||||||||:|||::||.|||.||||||..|.|||:|.||||:||||||||||.||::|..:
 Worm  1029 NTLYRFWSFFLRDNFNRNMYEEFRKLALEDAEIGSRYGIEALFRFYSYGLEKKFRPEIYKNFMKD 1093

  Fly  1435 TIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFR 1483
            ...|.:.|:||||||.:|||:..|..::|.|...|.:.|..:|:.:|||
 Worm  1094 VTTDVQKGELYGLEKLFAFLQRSKIAKQLVVDDYLTKELNKYKSTDDFR 1142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 42/74 (57%)
DM15 1341..1382 CDD:128927 24/41 (59%)
DM15 1383..1421 CDD:128927 28/38 (74%)
larp-1NP_001040868.3 LARP_1_2 580..654 CDD:153403 42/74 (57%)
DM15 1001..1041 CDD:128927 24/41 (59%)
DM15 1042..1080 CDD:128927 28/38 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131193122
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 275 1.000 Inparanoid score I1768
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 1 1.000 T474946
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR22792
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1945
TreeFam 1 0.960
98.880

Return to query results.
Submit another query.