Sequence 1: | NP_001247347.1 | Gene: | larp / 53567 | FlyBaseID: | FBgn0261618 | Length: | 1673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491411.1 | Gene: | ssb-1 / 172070 | WormBaseID: | WBGene00016653 | Length: | 396 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 58/264 - (21%) |
---|---|---|---|
Similarity: | 107/264 - (40%) | Gaps: | 72/264 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 719 AAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKM-DPEGYIPVTLIASFHRVLALTTDVAV 782
Fly 783 IVNAIKES------------------------DKLELFEGYKVRT---KTTPTTWPITEVPE-VN 819
Fly 820 E-GEPKAIGTLEQEQLEQNDG--------QEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPR 875
Fly 876 NPQNLVPKMLQDK---------QQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVK 931
Fly 932 PKST 935 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
larp | NP_001247347.1 | LARP_1_2 | 730..803 | CDD:153403 | 27/97 (28%) |
DM15 | 1341..1382 | CDD:128927 | |||
DM15 | 1383..1421 | CDD:128927 | |||
ssb-1 | NP_491411.1 | LARP_3 | 9..90 | CDD:153397 | 26/83 (31%) |
RRM1_La | 111..183 | CDD:240737 | 12/93 (13%) | ||
RRM_3 | 230..328 | CDD:285930 | 4/14 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5193 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |