DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment larp and ssb-1

DIOPT Version :9

Sequence 1:NP_001247347.1 Gene:larp / 53567 FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_491411.1 Gene:ssb-1 / 172070 WormBaseID:WBGene00016653 Length:396 Species:Caenorhabditis elegans


Alignment Length:264 Identity:58/264 - (21%)
Similarity:107/264 - (40%) Gaps:72/264 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   719 AAYIELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKM-DPEGYIPVTLIASFHRVLALTTDVAV 782
            ||.:..||:   :.|.||:||||...||..|.||:.|: :.:|::|:|.:.:|:|:.:::.|...
 Worm     5 AAAVHDDAD---QKIIKQLEYYFGNINLPRDKFLQEKLKEDDGWVPITTMLNFNRLASISKDTEK 66

  Fly   783 IVNAIKES------------------------DKLELFEGYKVRT---KTTPTTWPITEVPE-VN 819
            |.||:|.|                        :.||.::..|.||   |...|...:.::.: .|
 Worm    67 IANAVKNSGSGIISVSEDNQKIRRNEENPVPENSLEYWQKIKHRTVYMKGFSTDTQLDDIIQWAN 131

  Fly   820 E-GEPKAIGTLEQEQLEQNDG--------QEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPR 875
            : ||.:   .:...:|:..|.        ..|..|:.||.....:                   :
 Worm   132 QFGETE---NVLMRRLKPGDRTFKGSVFITYKTREEAEAAQKAEV-------------------K 174

  Fly   876 NPQNLVPKMLQDK---------QQSRSSTIAALNSVNAISALTQQVEGGAAELAGHLSGLAESVK 931
            ..:..:.||:||:         :::|::..||.::.|...|:..:....|......|....:.:.
 Worm   175 FGETELTKMMQDEYWTLKNKETKEARAANKAAKSAKNTSEAIESEKAQHAVRYEKGLILAVDGLG 239

  Fly   932 PKST 935
            |.||
 Worm   240 PDST 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 27/97 (28%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
ssb-1NP_491411.1 LARP_3 9..90 CDD:153397 26/83 (31%)
RRM1_La 111..183 CDD:240737 12/93 (13%)
RRM_3 230..328 CDD:285930 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.