DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp1

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_012814168.1 Gene:larp1 XenbaseID:XB-GENE-6039336 Length:1016 Species:Xenopus tropicalis

Alignment Length:1416 Identity:444/1417 (31%)
Similarity:578/1417 (41%) Gaps:489/1417 (35%)


  Fly   205 VPGGPKVHKDRKDTSPSASIEGAGSSGNEAKSADGDQ-QAGEKGAAGAAPPP--KRFIAAPPPKV 266
            :|..|.:...::...|...||       |.:...|.| ||.|.|..|.....  |.|:.||||||
 Frog    10 LPANPLLPPLQQQPPPEEMIE-------ERRPEGGKQRQAKEDGGTGGEEVQLRKEFVEAPPPKV 67

  Fly   267 NAWKISAKQSGSPKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGA 331
            |.|   .|..||...|..|.:..|          ..|...:.|:               :|::|:
 Frog    68 NPW---MKAGGSTVNGQLPAEPPV----------PAKVVKAGNS---------------RPRRGS 104

  Fly   332 TTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATTTTVDASQADALAKVVVKD 396
                                                                             
 Frog   105 ----------------------------------------------------------------- 104

  Fly   397 KKKVNQKASDFSNVGDWPTLIGGTSGSGKATSNEPKRNPTKKQQSAKTAAAVAASSNTTSSEVAT 461
                  |..||.:..:|||       .|: .:::..:.|||.|...|:..  .......|::...
 Frog   105 ------KVGDFGDATNWPT-------PGE-IAHKTVQPPTKLQPGRKSLG--KKDMKEESADGKE 153

  Fly   462 ESNVAGTTSSSNSNPSSSTTTTNTTTNSQATTAPVASTSHDAKAQRDAE-----PAANSAAGTTG 521
            ...|....||...|                         .|...||.|.     ||.|       
 Frog   154 NQRVKSDESSEEKN-------------------------GDDDGQRSANKKKAFPAGN------- 186

  Fly   522 TAAGPALTKKIPKHKWRPLPIDLAKSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAG 586
                        ||||.||.|::      ||.|                         |....|.
 Frog   187 ------------KHKWVPLQIEM------KPDG-------------------------PREKNAS 208

  Fly   587 VESRHPHAGRHPYG-SRPATA----TSERVDSWRSSSSTTTAAFDEQRSGAAGGA---GAAGTGV 643
            ..:|.....|||.. |.|.|.    .|||  .|:.        ||:..|..:.||   |..|.|.
 Frog   209 RNNRQNEQQRHPLNRSDPKTMYPDNKSER--DWQD--------FDDTSSVKSEGAIRGGFRGRGR 263

  Fly   644 GSATRGPRRYRTPYRGGRQGRGGFSRQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVL 708
            |   ||        ||..:||||      .|..:..|         ..|...|.:.......::.
 Frog   264 G---RG--------RGRGRGRGG------TRSHFDYP---------YGYRKFDGSDVTRGPKFLS 302

  Fly   709 MGTHYFGNVPAAYI-ELDANSIKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHR 772
            ..|:|:.|:.::.: .:|...:|:.||:|:|||||||||..|||||||||.||::||.|||||||
 Frog   303 NITYYYDNMSSSELYSVDQELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHR 367

  Fly   773 VLALTTDVAVIVNAIKESDKLELFEGYKVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQN 837
            |.|||||:.:||.|:|:|..:|:.: .|:|.|..|..||:                         
 Frog   368 VQALTTDIELIVKALKDSKVVEIID-EKIRRKDQPDMWPL------------------------- 406

  Fly   838 DGQEKLEEQTEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSV 902
                          |.|.|:.|..| ..|.:      .|....||     :|..:..|.:|..|.
 Frog   407 --------------PGPSLSDASQT-DFNQL------INCPEFVP-----RQGFQKETESAPGSP 445

  Fly   903 NAIS-ALTQQVEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKE 966
            ...| |.|.:.|        .:|.|....|..|.|.||    ..:.|               |.|
 Frog   446 RTSSPARTTKSE--------EVSNLKTMPKGLSASLPD----LDSDN---------------WIE 483

  Fly   967 VKRRSKTNAIKENATTPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVT 1031
            ||:|.:                                              ||.|         
 Frog   484 VKKRPR----------------------------------------------PSPA--------- 493

  Fly  1032 TNNASSATKATTKTTTTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQF 1096
                  .||...|:....|....|...                     ||..|  .|.|||||.|
 Frog   494 ------RTKDEVKSPQVVTPLQVTPQK---------------------PPKDQ--DEPEELDFMF 529

  Fly  1097 DEEL--MDPLPPGTGRINNFTENFSDDDESDYEFADRDINKLLIVAQVGRA-PKHEGYDRTADFT 1158
            |||:  ||      ||.|.||: :||:| ||||..|||:||:|||.|...: .||.|.|||.:.|
 Frog   530 DEEMEQMD------GRKNTFTD-WSDED-SDYEIDDRDVNKILIVTQTPPSLRKHPGGDRTGNHT 586

  Fly  1159 SRTKITQDLENIINDGLVNYEEDLWT---------TTNVVADYKTVNVISQADFEKLAGGRNKSV 1214
            ||.|::.:...:|||||..||:||||         ....|.::|.||:||:..|:.|.  ....|
 Frog   587 SRAKMSSEFAKVINDGLFYYEQDLWTEQFEPEYSQIKQEVENFKKVNMISREQFDTLT--PEPPV 649

  Fly  1215 LPPQVVPP-PPPFE----EDLDETLVG---DTTLNSTLNNTLKS----RRA-------------- 1253
            .|.|.||| ||.|:    :||...|.|   .:|:..:|..|:..    |.|              
 Frog   650 DPNQEVPPGPPRFQQVPTDDLANKLFGAPEPSTIARSLPTTVPESPNYRNARTPRTPRTPRLKDP 714

  Fly  1254 ----RFY-AAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSSAGTSPTAS 1313
                ||| ......:||.:||||||.||::|||:|.||||::|:.||||||.|:.|:|..|..|.
 Frog   715 TLTPRFYPVVKEGRTIDAKTPRKRKTRHSSNPPMECHVGWVMDSREHRPRTASVSSTASPSEVAP 779

  Fly  1314 SYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSF 1378
            :..::|.: |||||.||||||.|||||.|||..||||..|||.||:|||.|||||||||:|||||
 Frog   780 ALSNYGCT-PQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSF 843

  Fly  1379 FLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQ 1443
            |||::|||.||.|||.||:||:..|:|||||||||::|||||||||.:|::|||:||..||||||
 Frog   844 FLRDHFNKKMYEEFRQLAVEDSKEGYRYGLECLFRYYSYGLEKKFRVDIFRDFQEETRRDYETGQ 908

  Fly  1444 LYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRVVEPEINEMLQGVG----SLNPGRQ 1504
            |||||||||||||.| .:.|::.|.|.|||..|:.:|||| |:|.:.|  .|..    ||:.|..
 Frog   909 LYGLEKFWAFLKYSK-AKNLDIDPILQEYLSKFRRLEDFR-VDPPMGE--DGGSKRRHSLSTGEG 969

  Fly  1505 LNRHRSVSESDGTAVIAAGGRRLNTTITNRSDYVGRLLQQQHQQQQQQQHH 1555
            ..|:.|.|.|.|:      |.:.:|             |...:::.:.|.|
 Frog   970 RRRYPSQSSSRGS------GHQTST-------------QNSAREEAKAQSH 1001

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 47/73 (64%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 27/38 (71%)
larp1XP_012814168.1 LAM 325..397 CDD:295455 47/73 (64%)
DM15 807..847 CDD:128927 32/40 (80%)
DM15 848..886 CDD:128927 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.780

Return to query results.
Submit another query.