DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp4b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:XP_012819819.1 Gene:larp4b XenbaseID:XB-GENE-966333 Length:1742 Species:Xenopus tropicalis

Alignment Length:705 Identity:142/706 (20%)
Similarity:225/706 (32%) Gaps:248/706 (35%)


  Fly   729 IKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKL 793
            :::.:||.:|:..|.:||..|.:|..:||.:.|:|:..:|:...|..|:||:.:||:.::....:
 Frog  1160 LRDLLKKTLEFCLSRENLASDMYLISQMDSDQYVPIMTVANLDLVKKLSTDMDLIVDVLRSLPLV 1224

  Fly   794 ELFE-GYKVR---------TKTTPTTWPITEVPEVNEGE--PKAIGTLEQEQLEQNDGQEKLEEQ 846
            ::.| |.|||         .:..|.:.|:.||..:.:||  ||.|..    :...||.. .:..:
 Frog  1225 QVDEKGEKVRPNQNRCIVILREVPESTPVEEVEALFKGENLPKFINC----EFAYNDNW-FITFE 1284

  Fly   847 TEADSPPPILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQ 911
            :|||:                          |.....:.::.:..:...|.|.....||:..|  
 Frog  1285 SEADA--------------------------QQAYKYLREEVKTFQGKPIKARIKAKAIAINT-- 1321

  Fly   912 VEGGAAELAGHLSGLAESVKPKSTSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAI 976
                              ..||:...|...|             |.|:                 
 Frog  1322 ------------------FLPKNGYRPLDMN-------------LYAQ----------------- 1338

  Fly   977 KENATT----PP---QQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNN 1034
             :..||    ||   .|||.||...:        |..|.|.:.|..:      .|..|....|..
 Frog  1339 -QRYTTSFYIPPVYSPQQQFPLYSLI--------TPQTWSTAHSYLD------PSLVTPFPNTGF 1388

  Fly  1035 ASSATKATTKTTTTSTAT----TTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQ 1095
            .:..|..|.|...:..||    |..|.|       ..|:|.:.:.                    
 Frog  1389 INGFTSPTFKPAASPLATLRPYTPRNRN-------PGKSHLRHTI-------------------- 1426

  Fly  1096 FDEELMDPLPPGTGR---------INNFTENFSDDDESDYEFADRDINKLLIVAQVGRAP-KHEG 1150
                      |.|.|         |.|||             .||.||      .|..|| :..|
 Frog  1427 ----------PSTDRGPALLDGPTIFNFT-------------TDRLIN------GVRAAPTRQPG 1462

  Fly  1151 YDRTADFTSRTKITQDLENIINDGLVNYEEDLWTTTNVVADYKTVNVISQADFEKLAGGRNKSVL 1215
            .:||....:.|.:.::    |..|.|. ..::.|:..:....|......:...:|.:.|..:|  
 Frog  1463 QNRTRMQNASTFVKRE----IGTGRVE-PTNIDTSPGLGRGRKNSYGYRKKREDKFSRGPTQS-- 1520

  Fly  1216 PPQVVPPPPPFE------------------EDLDE----TLVGDTTLNSTLN-----NTLKSRRA 1253
            ||.:.||.|.||                  ||..|    |||..|:....||     ||:.|...
 Frog  1521 PPPMKPPSPSFELGLSSFPPLPGAAGNLKPEDFFENRMSTLVISTSKEKNLNVDASTNTVPSGIP 1585

  Fly  1254 R------------FYAAPNSHSIDPRTPRKRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSSA 1306
            |            .:.:|.|.|..|...:...::...:|.:| .:...|.|.....:.    :.|
 Frog  1586 REPLLPIPAALPVTFQSPPSPSHSPDESKMIDVQQRESPTIE-RISATLTTASKSVQV----NGA 1645

  Fly  1307 GTSPTASSYGSFGSSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRL 1361
            .|.....||........:..|..|.....  |:|:          :.|.||.::|
 Frog  1646 ATELRKPSYAEICQRTSKDAPTLQPTKDQ--KQNS----------TACAKEEKKL 1688

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 24/83 (29%)
DM15 1341..1382 CDD:128927 4/22 (18%)
DM15 1383..1421 CDD:128927
larp4bXP_012819819.1 LARP_4_5_like 1161..1235 CDD:153400 24/74 (32%)
RRM_LARP5 1240..1316 CDD:241150 17/107 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121326681
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.