DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: larp and larp1b

Sequence 1:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster
Sequence 2:NP_001121461.1 Gene:larp1b XenbaseID:XB-GENE-5737452 Length:991 Species:Xenopus tropicalis

Alignment Length:1291 Identity:394/1292 (30%)
Similarity:539/1292 (42%) Gaps:424/1292 (33%)


  Fly   292 QPKAQQQQQQTKQTASQNNNAQNTASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATT 356
            :|:...:....|:.....::.|.:|  .||.:..||:....|..|:                   
 Frog    22 RPQKPDENNSNKENTKGQSSCQMSA--HKTVEAPQPRVNPWTKKQS------------------- 65

  Fly   357 SAAAATSSAAAVPAATTETATTTTV---DASQADALAKVVVKDKKKVNQKASDFSNVGDWPTLIG 418
                              .||..||   |.......|| |::..|..::|.|||.::.:|||   
 Frog    66 ------------------LATNNTVYFHDHQGQQGTAK-VIRAGKPPSKKTSDFHDITNWPT--- 108

  Fly   419 GTSGSGKATSNEPKRNPTKKQQSAKTAAA--VAASSNTTSSEVATE-SNVAGTTSSSNSNPSSST 480
                        |........|:...|||  .|||....||:..|: .:|..|..:.|    ...
 Frog   109 ------------PSEIANHGTQNVLCAAANGKAASKQEKSSDGKTDHKDVCETKENCN----MEV 157

  Fly   481 TTTNTTTNSQATTAPVASTSHDAKAQRDAEPAANSAAGTTGTAAGPALTKKIPKHKWRPLPIDLA 545
            ...|...|.|.          :|.||:                      ||..|.||.||.|:..
 Frog   158 QVKNPKPNDQV----------EATAQK----------------------KKFNKQKWMPLHIEET 190

  Fly   546 KSSRPKPIGGRPNRRFSDDIADQRRPPRVYHDRQPGAGGAGVESRHPHAGRHPYGSRPATATSER 610
            |:.:                   :..|.::.:    :......||:.::.:..|           
 Frog   191 KTVK-------------------QESPTIHKN----SSSQCEVSRNQNSKQRDY----------- 221

  Fly   611 VDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGSATRGPRRYRTPYRGGRQGRGGFSRQGPGRP 675
              |||..   .....||..|..:.|....|:               .||..:|||    :|.|||
 Frog   222 --SWRLD---RRRELDEVSSVHSEGGNIRGS---------------LRGSGRGRG----RGRGRP 262

  Fly   676 ----TYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGT--HYFGNVPAAYIELDANSIKEAIK 734
                :|....:.:.:....||        .|...|...||  |.:        .:|...:||.:|
 Frog   263 YMHYSYSARENRMRTDHIENY--------KSMMYYYDDGTGMHVY--------PVDKKLLKEYLK 311

  Fly   735 KQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFEGY 799
            :|:|||||.:||..|||||||||.:|::|::|||.|:||.:|||||.::..|:|:|.::|:.: .
 Frog   312 RQIEYYFSTENLEKDFFLRRKMDLQGFLPLSLIAGFYRVQSLTTDVDLMCEALKDSVEVEIVD-Q 375

  Fly   800 KVRTKTTPTTWPITEVPEVNEGEPKAIGTLEQEQLEQNDGQ-----------EKLEEQTEADSPP 853
            |:|.|..|..|||...|.::              |.:.|..           :|||..|      
 Frog   376 KIRRKVDPEKWPIPSAPSLD--------------LTRTDFSRFIDCPEFIPGKKLESHT------ 420

  Fly   854 PILTSAMATKPLNSIPPPPMPRNPQNLVPKMLQDKQQSRSSTIAALNSVNAISALTQQVEGGAAE 918
                        .|:|..|...      ...|||          ..|.:|.:.::          
 Frog   421 ------------GSVPNSPRKE------CSFLQD----------GSNKLNNLQSM---------- 447

  Fly   919 LAGHLSGLAESVKPK--STSTPDKRNAASAGNGAGSAAALVAEPEGIWKEVKRRSKTNAIKENAT 981
                         ||  |:|.|:                |.:||   |.|||:|.:.:.|     
 Frog   448 -------------PKVLSSSMPE----------------LDSEP---WIEVKKRRRPSPI----- 475

  Fly   982 TPPQQQQPPLSQTLNNNNDNVKTNNTSSKSKSSSNNAPSNASSSATVCVTTNNASSATKATTKTT 1046
                                          ||...:.|:..:|...:|                 
 Frog   476 ------------------------------KSKEPDIPTQITSKPQLC----------------- 493

  Fly  1047 TTSTATTTTNNNIKSGNAAYSKTHSKSSSKTAAPPSAQCHAEKEELDFQFDEELMDPLPPGTGRI 1111
                                                  ...:.|:|||.|||||...    .||.
 Frog   494 --------------------------------------DEPDPEDLDFMFDEELQHM----QGRK 516

  Fly  1112 NNFTENFSDDDESDYEFADRDINKLLIVAQV-GRAPKHEGYDRTADFTSRTKITQDLENIINDGL 1175
            |.||: :|||| ||||..|:|:||::||.|. ....||.|.|||.:..||.|:|.:|..:|||||
 Frog   517 NTFTD-WSDDD-SDYEIDDKDLNKIIIVTQTPPHLKKHPGGDRTGNHISRAKMTSELAKVINDGL 579

  Fly  1176 VNYEEDLW---------TTTNVVADYKTVNVISQADFEKLAG----GRNKSVLPPQVVPPPPPFE 1227
            ..||:|||         .:...:..::.:|:||:.:|:.||.    .:|....|..:    |.|:
 Frog   580 YYYEKDLWMDCEEQNYVPSKQELEHFRKLNLISKEEFDNLAPEFQIEQNLEQSPLNI----PTFQ 640

  Fly  1228 EDLDETLVGDTTLN-----------STLNNTLKSRRA----------RFY-AAPNSHSIDPRTPR 1270
            :...|...|..|..           |....|.||.|.          ||| ....:.|||.::||
 Frog   641 QVCCEDFHGPATTQFHPTDVQQSPMSCHARTPKSPRTPRLKDPSKTPRFYPVVKEARSIDVQSPR 705

  Fly  1271 KRKLRHTANPPVEAHVGWLLDTVEHRPRTTSMGSS-AGTSPTASSYGSFGSSVPQSLPVFQHPSH 1334
            |||.||:.|||:|.||||::|:.||||||:|:.|| |..|..|...||:|.: |.|||.||||||
 Frog   706 KRKTRHSTNPPLEYHVGWVMDSKEHRPRTSSVSSSNASPSEVAPLTGSYGCT-PHSLPKFQHPSH 769

  Fly  1335 ALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALED 1399
            .|||||.||||.||||..|||.||::||.|||.||||||||||||||::|||.||.|||.||:|:
 Frog   770 ELLKENGFTQQVYHKYRRRCLNERKKLGVGQSPEMNTLYRFWSFFLRDHFNKKMYEEFRQLAVEE 834

  Fly  1400 AGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLE 1464
            |...:||||||||||:|||||:|||..:::|||:||:.|||.|||||||||||:|||.| .:.|.
 Frog   835 AKENYRYGLECLFRFYSYGLERKFRQELFEDFQEETVKDYEHGQLYGLEKFWAYLKYSK-AKNLS 898

  Fly  1465 VQPKLAEYLKSFKNIEDFRVVEP--EINEMLQGVGSLNPGRQLNRHRSVSESDGTA 1518
            |.|||..||..||.:|||||..|  |.|..:....:.:|||:  ||||.|.....|
 Frog   899 VDPKLQSYLSKFKRLEDFRVDPPIAEENGRMTSASNEDPGRR--RHRSGSSKHSPA 952

Known Domains:


GeneSequenceDomainRegion External IDIdentity
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 39/73 (53%)
DM15 1341..1382 CDD:128927 32/41 (78%)
DM15 1383..1421 CDD:128927 27/38 (71%)
larp1bNP_001121461.1 LARP_2 307..379 CDD:153407 39/73 (53%)
DM15 777..817 CDD:128927 32/40 (80%)
DM15 818..856 CDD:128927 27/38 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121183787
eggNOG 1 0.900 E1_COG5193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D258488at2759
OrthoFinder 1 1.000 FOG0001428
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.