DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and SOX14

DIOPT Version :10

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_004180.1 Gene:SOX14 / 8403 HGNCID:11193 Length:240 Species:Homo sapiens


Alignment Length:77 Identity:29/77 - (37%)
Similarity:47/77 - (61%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1232 IRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLH 1296
            |:|||||||::|:..|:.:.:::|...|..:||.||..|..|...:|..|.:.|..::..|.|.|
Human     8 IKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEH 72

  Fly  1297 PEWKWCSKDRRK 1308
            |::|:  :.|||
Human    73 PDYKY--RPRRK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..432 CDD:465014
HMG-box_CIC-like 1231..1308 CDD:438806 27/75 (36%)
SOX14NP_004180.1 HMG-box_SoxB 6..85 CDD:438790 29/77 (38%)
SOXp 77..>118 CDD:463537 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.