DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cic and sox21b

DIOPT Version :10

Sequence 1:NP_001262755.1 Gene:cic / 53560 FlyBaseID:FBgn0262582 Length:2150 Species:Drosophila melanogaster
Sequence 2:NP_001009888.1 Gene:sox21b / 406246 ZFINID:ZDB-GENE-040429-1 Length:245 Species:Danio rerio


Alignment Length:80 Identity:28/80 - (35%)
Similarity:48/80 - (60%) Gaps:2/80 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1232 IRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYHELASSVKDAHFKLH 1296
            ::|||||||::|:..|:.:.:::|...|..:||.||..|..|...:|..:.:.|..::..|.|.|
Zfish     8 VKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEH 72

  Fly  1297 PEWKWCSKDRRKSST 1311
            |::|:  :.|||..|
Zfish    73 PDYKY--RPRRKPKT 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cicNP_001262755.1 DUF4819 349..432 CDD:465014
HMG-box_CIC-like 1231..1308 CDD:438806 25/75 (33%)
sox21bNP_001009888.1 HMG-box_SoxB 6..85 CDD:438790 27/78 (35%)
SOXp 77..>95 CDD:463537 4/11 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.