DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and Sgpp1

DIOPT Version :10

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_109675.1 Gene:Sgpp1 / 81535 MGIID:2135760 Length:430 Species:Mus musculus


Alignment Length:79 Identity:19/79 - (24%)
Similarity:33/79 - (41%) Gaps:13/79 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 SFPSGHASFACYSMLYLVIYLHRRMQWKQLRMLCHLLQFLLLMFAW--YTALTRVSDYKHHWSDV 331
            |.||.||.......:.:.:..:.|.|:.       |:..|:|:..|  ...|:|:....|...||
Mouse   192 SMPSTHAMSGTAIPIAMFLLTYGRWQYP-------LIYGLILIPCWSSLVCLSRIYMGMHSILDV 249

  Fly   332 LAGSGIGLTYAVVV 345
            :|    |..|.:::
Mouse   250 IA----GFLYTILI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479 19/79 (24%)
Sgpp1NP_109675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..103
PAP2_SPPase1 117..264 CDD:239482 19/79 (24%)
Phosphatase sequence motif I. /evidence=ECO:0000305 167..175
Phosphatase sequence motif II. /evidence=ECO:0000305 194..197 2/2 (100%)
Phosphatase sequence motif III. /evidence=ECO:0000305 237..248 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.