DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wun2 and sgpp1a

DIOPT Version :10

Sequence 1:NP_524991.1 Gene:wun2 / 53558 FlyBaseID:FBgn0041087 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_684347.1 Gene:sgpp1a / 556439 ZFINID:ZDB-GENE-030131-4695 Length:436 Species:Danio rerio


Alignment Length:150 Identity:33/150 - (22%)
Similarity:47/150 - (31%) Gaps:45/150 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LQLPTFVDSTRSQGSLYAVASNKKP-------------PLRGPRQIFG-RILTDLCLLSCVGLPM 105
            :::..|.:|..|..|.:|::....|             |.     :|| .|.....:|.|:....
Zfish   187 VKVEVFYNSEYSMPSTHAMSGTALPFSLFLLTCSRWEYPF-----MFGLSIALFWSILVCISRIY 246

  Fly   106 LGFSLWGEAVKRGFFCDDSSLR--HPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSP 168
            :|.....|.: .||......|.  ||..|...   ..||.....||.|:||           |  
Zfish   247 MGMHSVLEVI-TGFLYSVLILAVLHPMLDDID---TFYLSHSYAPLVVLLV-----------H-- 294

  Fly   169 FPKSTMCSGYHLCHLELPTW 188
                   .|:.|....|.||
Zfish   295 -------VGFSLVAFSLDTW 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wun2NP_524991.1 PAP2_wunen 191..346 CDD:239479
sgpp1aXP_684347.1 PAP2_SPPase1 121..270 CDD:239482 17/88 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.