DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and colec10

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001276917.1 Gene:colec10 ZFINID:ZDB-GENE-131127-525 Length:271 Species:Danio rerio

Alignment Length:164 Identity:36/165 (22%)
Similarity:58/165 (35%) Gaps:39/165 (24%)


  Fly    90 KLRALKQQIEPYMENVKMSNKIKMSVFKKI--GSRH----FYLEKQKKMPWDSAYDTCRQMGGH- 147
            |.|.:..|::..:..||  |.||.  .||:  |.|.    |||...:...:..:...|:..||. 
Zfish   112 KYRKVIGQMDASISKVK--NAIKF--IKKVVLGIRETENMFYLLVTEARTYQQSLLNCKLRGGTL 172

  Fly   148 -----------LANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLK---WK 198
                       |||.:.|.:||.:|             .|...|.:.:..:.....|.|.   |.
Zfish   173 AMSRTEEKNNLLANFIKEADLNHVF-------------IRLQAGVTEVGYMYLNGNPLLNTTAWA 224

  Fly   199 PNLATNIHNHCVYI-NSNEMYFENCANDNYFACQ 231
            ...|.:....||.: .:..:...:|....|:.|:
Zfish   225 IQGADSGKGDCVQLGRTGALSQVDCGATQYYICE 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/116 (18%)
colec10NP_001276917.1 Collagen 54..106 CDD:189968
CLECT 148..259 CDD:295302 24/125 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.