DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and COLEC11

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 HGNCID:17213 Length:285 Species:Homo sapiens

Alignment Length:177 Identity:36/178 (20%)
Similarity:67/178 (38%) Gaps:41/178 (23%)


  Fly    69 IGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMP 133
            ||.|:.::        :|:.::|:.:|..:....|.               .|:.:.|.|::|. 
Human   136 IGEMDNQV--------SQLTSELKFIKNAVAGVRET---------------ESKIYLLVKEEKR- 176

  Fly   134 WDSAYDTCRQMGGHLANILDEKE---LNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFL 195
            :..|..:|:..||.|:...||..   :....::....:.::.||....:||...|..|.... |.
Human   177 YADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRT-FN 240

  Fly   196 KWKPNLATNIHNH--CVYINSNEMYFEN------CANDNYFACQAEQ 234
            ||:.....|.::.  ||     ||....      |....||.|:.::
Human   241 KWRSGEPNNAYDEEDCV-----EMVASGGWNDVACHTTMYFMCEFDK 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/111 (23%)
COLEC11NP_001242914.1 Collagen 58..111 CDD:189968
CLECT_collectin_like 165..280 CDD:153061 29/122 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.