DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-22C

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster

Alignment Length:205 Identity:65/206 (32%)
Similarity:101/206 (49%) Gaps:37/206 (18%)


  Fly    58 NSLRQNGTLWRIGNME---------------------QRLEMRLQSFQ---NQMETKLRALKQQI 98
            ||.:.|..|.|...||                     ::|.:..|:|.   |.||..|.||::.:
  Fly    63 NSSKANEVLVRQYTMEGQLTALQNKQLSIEVALDAQGRKLNVNEQNFTERLNCMEGILSALEKTV 127

  Fly    99 EPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEI--- 160
                  :::..|||...|::|||:::|:||..:..|.:|..|||.||||||:|.||.:|..|   
  Fly   128 ------LEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKAN 186

  Fly   161 FSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHN-HCVYINSNEMYFENCAN 224
            ..|:|  .||:.||...::| .::|..:|:...||||.....:.:.. :||::.:.|||...|..
  Fly   187 LKEDT--HYWLGINDLDHEG-KFLSMPTGKQTTFLKWASGRPSQLDTLNCVFLYNGEMYDYPCHY 248

  Fly   225 DNYFACQAEQ 234
            ...|.||.|:
  Fly   249 TFRFICQTEE 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 37/104 (36%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 40/112 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133873952
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.