DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and SFTPA2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_005270185.1 Gene:SFTPA2 HGNCID:10799 Length:265 Species:Homo sapiens

Alignment Length:213 Identity:46/214 (21%)
Similarity:76/214 (36%) Gaps:47/214 (22%)


  Fly    30 GTNELPKAP-MPYYTIENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRA 93
            |.|.||.|| :|....|.           ....:.|......::::.|:..|..|::|:.....|
Human    88 GNNGLPGAPGVPGERGEK-----------GEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGA 141

  Fly    94 LKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELN 158
            |..|           ..| |:|.:|:     :....:.:.:|:..:.|.:.||.:| :....|.|
Human   142 LSLQ-----------GSI-MTVGEKV-----FSSNGQSITFDAIQEACARAGGRIA-VPRNPEEN 188

  Fly   159 EIFSEETKK--KY-WVDINSRANDGASWISTLSGRDVPFLKW-KPNLATNIHNHCVYINSNEMYF 219
            |..:...||  .| :|.:....:.|....|  .|..|.:..| :...|......||     |||.
Human   189 EAIASFVKKYNTYAYVGLTEGPSPGDFRYS--DGTPVNYTNWYRGEPAGRGKEQCV-----EMYT 246

  Fly   220 E------NCANDNYFACQ 231
            :      ||.......|:
Human   247 DGQWNDRNCLYSRLTICE 264

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/110 (24%)
SFTPA2XP_005270185.1 Collagen 45..117 CDD:189968 9/40 (23%)
CLECT_collectin_like 153..265 CDD:153061 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.