DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and SFTPA1

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001087239.2 Gene:SFTPA1 HGNCID:10798 Length:263 Species:Homo sapiens

Alignment Length:171 Identity:37/172 (22%)
Similarity:65/172 (38%) Gaps:35/172 (20%)


  Fly    71 NMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWD 135
            ::::.|:..|..|::|:.....||..|           ..| |:|.:|:     :....:.:.:|
Human   117 HLDEELQATLHDFRHQILQTRGALSLQ-----------GSI-MTVGEKV-----FSSNGQSITFD 164

  Fly   136 SAYDTCRQMGGHLANILDEKELNEIFSEETKK--KY-WVDINSRANDGASWISTLSGRDVPFLKW 197
            :..:.|.:.||.:| :....|.||..:...||  .| :|.:....:.|....|  .|..|.:..|
Human   165 AIQEACARAGGRIA-VPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYS--DGTPVNYTNW 226

  Fly   198 -KPNLATNIHNHCVYINSNEMYFE------NCANDNYFACQ 231
             :...|......||     |||.:      ||.......|:
Human   227 YRGEPAGRGKEQCV-----EMYTDGQWNDRNCLYSRLTICE 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/110 (24%)
SFTPA1NP_001087239.2 Collagen 43..115 CDD:189968
CLECT_collectin_like 151..263 CDD:153061 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.