DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and SFTPD

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_003010.4 Gene:SFTPD HGNCID:10803 Length:375 Species:Homo sapiens

Alignment Length:153 Identity:31/154 (20%)
Similarity:58/154 (38%) Gaps:18/154 (12%)


  Fly    93 ALKQQIEPYMENVK-----MSNKIKMSVF---KKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLA 149
            :|:||:|.....|:     .|...|:.:|   :.:|.:.|......| |:..|...|.|.||.||
Human   226 SLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVK-PFTEAQLLCTQAGGQLA 289

  Fly   150 ---NILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNI--HNHC 209
               :..:...|.::...:.:..: :.:.....:|.....|  |..:.:..|.|....:.  ...|
Human   290 SPRSAAENAALQQLVVAKNEAAF-LSMTDSKTEGKFTYPT--GESLVYSNWAPGEPNDDGGSEDC 351

  Fly   210 VYINSNEMYFEN-CANDNYFACQ 231
            |.|.:|..:.:. |.......|:
Human   352 VEIFTNGKWNDRACGEKRLVVCE 374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/106 (20%)
SFTPDNP_003010.4 Collagen 46..98 CDD:189968
Collagen 130..201 CDD:189968
Surfac_D-trimer 224..269 CDD:286141 10/43 (23%)
CLECT_collectin_like 262..375 CDD:153061 22/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.