DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-24A

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster

Alignment Length:294 Identity:61/295 (21%)
Similarity:115/295 (39%) Gaps:78/295 (26%)


  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYY-----------TIENIDMHQQHW 54
            |::.:..:.::..:         ..:.|.||.::...|:|..           .:|.:.:||..|
  Fly     1 MFRLSVLVLNLLLV---------SHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVAIHQDKW 56

  Fly    55 FTYNSLRQNGTL----------------------------WRIGNMEQ----------------- 74
            .|...:..|...                            .::..||:                 
  Fly    57 NTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLT 121

  Fly    75 ----RLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWD 135
                |.:::|::.:|.|:    .:|.|::.|...:.....::.. |:|||.|:||:|:..::.|.
  Fly   122 VKLDRTKLQLEAIKNTMD----YMKAQMDGYFSAINGVQCLQPG-FEKIGDRYFYIEEDVELNWL 181

  Fly   136 SAYDTCRQMGGHLANILDEKELNEIFSE-ETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKP 199
            .|...||:||||||:|..::|.:.|..: :..|.|::.:|.....| .::|..||:...:.:|.|
  Fly   182 DAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTG-DFVSAASGKSCLYHEWGP 245

  Fly   200 NLA--TNIHNHCVYINSNEMYFENCANDNYFACQ 231
            ...  .|....||.|....|:..||..:..|.||
  Fly   246 GEPHHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 31/103 (30%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133873307
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.