DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-28C

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster

Alignment Length:230 Identity:70/231 (30%)
Similarity:113/231 (49%) Gaps:44/231 (19%)


  Fly    36 KAPMPYYTIENIDMHQQHWFT--------------------YNSLRQNGTLWR------IGNMEQ 74
            :|.||  .|.:|..||:.|.|                    ..||.::   |:      |.|...
  Fly    47 EALMP--LIGHIAQHQEQWKTCKLQEIQAQQRDIEKEIESQKTSLTES---WKKIIAEDIENRTN 106

  Fly    75 RLEMRLQSFQNQMETKLRALKQQIEPYMENVK-MSNKIK-MSVFKKIGSRHFYLEKQKKMPWDSA 137
            |.|::       ||.:|..|::.:.....::| ||.||. :..||:||||:.::|...:..|.||
  Fly   107 RSELK-------MEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSA 164

  Fly   138 YDTCRQMGGHLANILDEKELNEIFSEETK-KKYWVDINSRANDGASWISTLSGRDVPFLKWKPN- 200
            ...|::|||:||:|::|.:.|.|.|:.:| ..|.:.|:..|..|. :||..||:..|||||.|. 
  Fly   165 LSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGV-FISVSSGKRAPFLKWNPGE 228

  Fly   201 -LATNIHNHCVYINSNEMYFENCANDNYFACQAEQ 234
             |..::...||.|::..|:..:|.:|..:.|:|.:
  Fly   229 PLYEHVDQRCVSIHNGGMWVASCTSDFKYICEANE 263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 37/103 (36%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 22/99 (22%)
CLECT 160..260 CDD:153057 37/101 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.