DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and lectin-30A

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster

Alignment Length:240 Identity:86/241 (36%)
Similarity:139/241 (58%) Gaps:23/241 (10%)


  Fly     1 MYKYATCIFSIFALWNFWGVSAKKQDTSTGTNELPKAPMPYYTIENIDMHQQHWFTYNSLRQNGT 65
            |:||  |...:...|....|.|.|.:.          |:   .|:.:.::||.|||:.:|:::..
  Fly     1 MFKY--CFICVILAWASRDVLANKTEN----------PL---LIDQVAINQQQWFTFIALKESEM 50

  Fly    66 LWRIGNMEQRLEMRLQSFQNQMETKLRALK-----QQIEPYMENVKMSNKIKMSVFKKIGSRHFY 125
            ..:|..:|:.:|.||.:.|:::...|..|:     |.:|. :|.:::|::|..::|:::|:|.||
  Fly    51 QQKIVRIERSIEERLMAMQSKLAYALNELQTIMGNQSVET-LEKLRISHRINPALFQRMGTRRFY 114

  Fly   126 LEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKKKYWVDINSRANDGASWISTLSGR 190
            :||:.|..|..|.:||||:|||:|.|.||:|.|||||......:|:|:|:...:|. :.|:|:||
  Fly   115 IEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPAGVFWIDMNAMFKNGL-FASSLTGR 178

  Fly   191 DVPFLKWKPNLATNIHNHCVYINSNEMYFENCANDNYFACQAEQW 235
            ..||.|||.....|..: ||.:.:.|||.|||.|.:.|.||||||
  Fly   179 SPPFFKWKKEERGNKFD-CVNVYNKEMYNENCFNTHLFICQAEQW 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 45/100 (45%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 45/102 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C133872756
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4026
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002177
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.980

Return to query results.
Submit another query.