DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and Clec9a

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001102824.1 Gene:Clec9a / 502901 RGDID:1562513 Length:241 Species:Rattus norvegicus


Alignment Length:200 Identity:43/200 - (21%)
Similarity:82/200 - (41%) Gaps:39/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IENIDMHQQHWFTYNSLRQNGTLWRIGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMS 108
            :.::.|.|:.    ..:||:..|..:...::...::|:|.|..::..||: .....|...|...:
  Rat    61 VSSLVMEQRE----RLIRQDTALLNLTEWQRNHTLQLKSCQASLQRSLRS-GSNCNPCPPNWIQN 120

  Fly   109 NKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANILDEKELNEIFSEETKK-----K 168
            .|          |.::..::.:  .|:::..:|.:.|..|..| |.||..|..:....|     :
  Rat   121 GK----------SCYYAFDRWE--TWNNSKKSCLKEGDSLLQI-DSKEEMEFINLSIWKLKGGYE 172

  Fly   169 YWVDINSRA-------NDGASWISTLSGRDVPFLKWKPNLATNIHNHCVYINSNEMYFENCANDN 226
            |||.:....       .||:|.:|.|...|      :...|:.|   |.|:..:.:..:||:|..
  Rat   173 YWVGVFQDGPSGSWFWEDGSSPLSDLLPTD------RQLSASQI---CGYLKDHTLISDNCSNWK 228

  Fly   227 YFACQ 231
            ||.|:
  Rat   229 YFICE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 28/111 (25%)
Clec9aNP_001102824.1 ITAM-like 5..10
CLECT_NK_receptors_like 113..234 CDD:153063 32/142 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5382
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.