DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and colec10

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis

Alignment Length:173 Identity:33/174 (19%)
Similarity:72/174 (41%) Gaps:44/174 (25%)


  Fly    79 RLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQ 143
            |.:....|::..:..||..:: :::||       ::..::...:::|:.:::: .:..|...||.
 Frog   121 RYRKVVGQLDVNVAHLKSSLK-FVKNV-------IAGIRETDEKYYYIVREER-NYRDALTQCRI 176

  Fly   144 MGGHLANILDEKE-------------------LNEIFSEETKKKYWVDINSRANDGASWISTLSG 189
            .||.||...|:..                   :|:|  |:.|:..:.| ||.....:||.:    
 Frog   177 RGGTLAMPKDQATNSLIADYISKMGLFRVFIGINDI--EKEKQFVYAD-NSPLQTYSSWKA---- 234

  Fly   190 RDVPFLKWKPNLATNIHNHCVYINSNEMYFE-NCANDNYFACQ 231
                   .:||..:. :..||.:.|...:.: :|:...||.|:
 Frog   235 -------GEPNDGSG-YEDCVEMLSTGHWNDVDCSLTIYFVCE 269

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 26/120 (22%)
colec10NP_001011227.1 CLECT_collectin_like 155..270 CDD:153061 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.