DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and colec11

DIOPT Version :9

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio


Alignment Length:159 Identity:33/159 - (20%)
Similarity:70/159 - (44%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LKQQI-EPYMENVKMSNKIK-----------MSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGG 146
            |::.| |..::.|:::|::|           ::..|:..|:.:.|.|::|. :..|...|:..||
Zfish   118 LRKMIGEMDIQVVQLTNELKFIKNALPSPAAVAGIKETDSKVYLLVKEEKR-YREAEVFCQGRGG 181

  Fly   147 HLANILD---EKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHN- 207
            |||...|   .:.:....::....:.::.||....:| .::.........|.:|:.....|.:: 
Zfish   182 HLAMPKDAAANRAIAGYVTDAGLSRVYIGINDLEREG-HFVYVERSPMTTFSRWREGEPNNAYDD 245

  Fly   208 -HCV-YINSNEMYFENCANDNYFACQAEQ 234
             .|| .::|.|.....|....||.|:.::
Zfish   246 EDCVEMVSSGEWIDVACQLTMYFVCEFDK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 22/105 (21%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.