DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and colec11

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_009291466.1 Gene:colec11 ZFINID:ZDB-GENE-041114-11 Length:277 Species:Danio rerio

Alignment Length:159 Identity:33/160 (21%)
Similarity:70/160 (44%) Gaps:20/160 (13%)


  Fly    94 LKQQI-EPYMENVKMSNKIK-----------MSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGG 146
            |::.| |..::.|:::|::|           ::..|:..|:.:.|.|::|. :..|...|:..||
Zfish   118 LRKMIGEMDIQVVQLTNELKFIKNALPSPAAVAGIKETDSKVYLLVKEEKR-YREAEVFCQGRGG 181

  Fly   147 HLANILD---EKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHN- 207
            |||...|   .:.:....::....:.::.||....:| .::.........|.:|:.....|.:: 
Zfish   182 HLAMPKDAAANRAIAGYVTDAGLSRVYIGINDLEREG-HFVYVERSPMTTFSRWREGEPNNAYDD 245

  Fly   208 -HCV-YINSNEMYFENCANDNYFACQAEQ 234
             .|| .::|.|.....|....||.|:.::
Zfish   246 EDCVEMVSSGEWIDVACQLTMYFVCEFDK 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 23/106 (22%)
colec11XP_009291466.1 Collagen 44..102 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 26/117 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5300
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.