DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-29Ca and colec11

DIOPT Version :10

Sequence 1:NP_652640.1 Gene:lectin-29Ca / 53547 FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:153 Identity:33/153 - (21%)
Similarity:70/153 - (45%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LKQQI-EPYMENVKMSNKIK-----MSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQMGGHLANIL 152
            |::.| |..::.|:::|::|     ::..|:..|:.:.|.|::|. :..|...|:..|||||...
Zfish   118 LRKMIGEMDIQVVQLTNELKFIKNAVAGIKETDSKVYLLVKEEKR-YREAEVFCQGRGGHLAMPK 181

  Fly   153 D---EKELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHN--HCV-Y 211
            |   .:.:....::....:.::.||....:| .::.........|.:|:.....|.::  .|| .
Zfish   182 DAAANRAIAGYVTDAGLSRVYIGINDLEREG-HFVYVERSPMTTFSRWREGEPNNAYDDEDCVEM 245

  Fly   212 INSNEMYFENCANDNYFACQAEQ 234
            ::|.|.....|....||.|:.::
Zfish   246 VSSGEWIDVACQLTMYFVCEFDK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 22/105 (21%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 26/116 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.