DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and MBL2

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 HGNCID:6922 Length:248 Species:Homo sapiens

Alignment Length:145 Identity:27/146 (18%)
Similarity:59/146 (40%) Gaps:33/146 (23%)


  Fly   103 ENVKMSNKIKMSVFKKIGSRHFYLEKQKKMPWDSAYDTCRQM------------GGHLANILDEK 155
            |..::...:..|:.|::|:: |:|...:.|.::.....|.:.            .|.:.|::.|:
Human   118 EMARIKKWLTFSLGKQVGNK-FFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEE 181

  Fly   156 ELNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFLKW---KPNLATNIHNHCVYINSNEM 217
            ....|..|:|:.:: ||              |:|..:.:..|   :||.|.: ...||.:..|..
Human   182 AFLGITDEKTEGQF-VD--------------LTGNRLTYTNWNEGEPNNAGS-DEDCVLLLKNGQ 230

  Fly   218 YFE-NCANDNYFACQ 231
            :.: .|:..:...|:
Human   231 WNDVPCSTSHLAVCE 245

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 21/116 (18%)
MBL2NP_000233.1 CLECT_collectin_like 136..246 CDD:153061 23/128 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5349
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.