DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and CLEC17A

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A HGNCID:34520 Length:378 Species:Homo sapiens

Alignment Length:215 Identity:51/216 (24%)
Similarity:82/216 (38%) Gaps:41/216 (19%)


  Fly    51 QQHWFTYNSLRQNGTLW---------RIGNMEQRLEMRLQSFQNQMETK--------LRALKQQI 98
            |:.|..|..|....:|:         .|...|...|:|:.||| ||..:        |..||..|
Human   166 QKRWMVYLCLLVVTSLFLGCLGLTVTLIKYQELMEELRMLSFQ-QMTWRTNMTGMAGLAGLKHDI 229

  Fly    99 EPYMENVKMSNKIKMSVFKKIGSRH--------------FYLEKQKKMPWDSAYDTCRQMGGHLA 149
            .....:   :|:..:.::..:..|.              :|.....| .||.|...|::...||.
Human   230 ARVRAD---TNQSLVELWGLLDCRRITCPEGWLPFEGKCYYFSPSTK-SWDEARMFCQENYSHLV 290

  Fly   150 NILDEKELNEIF-SEETKKKYWVDINSRANDGASWISTLSGRDVPFLKWKPNLATNIHNH-CVYI 212
            .|....|.|.:. :..:.:.||:.:|.||.:| .| ..|.|..|....|:|....|||:. |..:
Human   291 IINSFAEHNFVAKAHGSPRVYWLGLNDRAQEG-DW-RWLDGSPVTLSFWEPEEPNNIHDEDCATM 353

  Fly   213 NSNEMYFE-NCANDNYFACQ 231
            |....:.: :|....|:.|:
Human   354 NKGGTWNDLSCYKTTYWICE 373

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 30/103 (29%)
CLEC17ANP_001191047.1 CLECT_DC-SIGN_like 254..374 CDD:153060 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.