DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: lectin-29Ca and Colec11

Sequence 1:NP_652640.1 Gene:lectin-29Ca FlyBaseID:FBgn0040098 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_006225797.1 Gene:Colec11 RGDID:1309678 Length:277 Species:Rattus norvegicus

Alignment Length:177 Identity:36/178 (20%)
Similarity:71/178 (40%) Gaps:35/178 (20%)


  Fly    69 IGNMEQRLEMRLQSFQNQMETKLRALKQQIEPYMENVKMSNKIKMSVFKKIGSRHFYLEKQKKMP 133
            ||.|:.::        .|:.|:::.:|.         .:.:...::..::..|:.:.|.|::|. 
  Rat   122 IGEMDNQV--------TQLTTEIKFIKN---------ALPSPAAVAGVRETESKIYLLVKEEKR- 168

  Fly   134 WDSAYDTCRQMGGHLANILDEKE---LNEIFSEETKKKYWVDINSRANDGASWISTLSGRDVPFL 195
            :..|..:|:..||.|:...||..   :....::....:.::.||....:||...|..|.... |.
  Rat   169 YADAQLSCQGRGGTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEREGAFVYSDRSPMQT-FN 232

  Fly   196 KWKPNLATNIHNH--CVYINSNEMYFENCAND------NYFACQAEQ 234
            ||:.....|.::.  ||     ||......||      .||.|:.::
  Rat   233 KWRSGEPNNAYDEEDCV-----EMVASGGWNDVACHITMYFMCEFDK 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
lectin-29CaNP_652640.1 CLECT 131..231 CDD:153057 27/111 (24%)
Colec11XP_006225797.1 Collagen 40..95 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 30/122 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.